SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379006105|ref|YP_005255556.1| from Sulfobacillus acidophilus DSM 10332

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379006105|ref|YP_005255556.1|
Domain Number 1 Region: 55-176
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 2.75e-42
Family Insert subdomain of RNA polymerase alpha subunit 0.0000255
Further Details:      
 
Domain Number 2 Region: 13-55,177-230
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 3.34e-31
Family RNA polymerase alpha subunit dimerisation domain 0.00054
Further Details:      
 
Domain Number 3 Region: 252-316
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 3.27e-25
Family C-terminal domain of RNA polymerase alpha subunit 0.0000795
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379006105|ref|YP_005255556.1|
Sequence length 320
Comment DNA-directed RNA polymerase subunit alpha [Sulfobacillus acidophilus DSM 10332]
Sequence
MRAGGVTEIEKPEIRRVDDGSQPNYGQFVVEPLERGYGITLGNSLRRILLSSLPGTAVTS
VRIDGVLHEFSVIPGVLEDTADIILNLKRLKLKLWSDEPKTVRIDKQGPGEVTAGDILAD
ADVDILDPSQHIAFVDEGGRLTMEMTVERGKGYVPADKNKRADQAIGVIPVDSIFSPVEK
ANWRVEDTRVGQITDYDRLTLEVWTDGSLTPEEAVSMGSKILTDHLRLFMGLTDGVAGAE
VGLERDEDKRDRLLDMPIEELDLSVRSFNCLKRAGINTVGELTSKTDEDMMKVRNLGKKS
LEEVKEKLASLGLSLKPSEE
Download sequence
Identical sequences G8TXI5
gi|379006105|ref|YP_005255556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]