SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|527317988|ref|YP_008344190.1| from Chlamydia trachomatis RC-L2s46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|527317988|ref|YP_008344190.1|
Domain Number 1 Region: 39-224
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.73e-21
Family DsbC/DsbG C-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|527317988|ref|YP_008344190.1|
Sequence length 238
Comment disulfide bond chaperone [Chlamydia trachomatis RC-L2(s)/46]
Sequence
MDTRTPLRKKILIISTALGFVLCVGLMIHTKRSIMPPKTHIPTTAKYFPTIGDPYAPINI
TVFEEPSCSACEEFSSEVFPLIKKHFVDTGEASLTLVPVCFIRGSMPAAQALLCVYHHDP
KRPDPEAYMEYFHRILTYKKTKGSHWATPEVLAKLAEKIPTHSGREINPKGLIQCINSQR
FTEQLKKNNIYGSQIMGGQLATPTAVVGDYLIEDPTFDEIERVITQLRHLQAIEEEVR
Download sequence
Identical sequences A0A0E9FUJ4 A0A0H2X0S4 A0A0H3MKQ1
WP_009873617.1.100883 WP_009873617.1.101735 WP_009873617.1.11148 WP_009873617.1.11732 WP_009873617.1.17082 WP_009873617.1.17422 WP_009873617.1.18643 WP_009873617.1.25195 WP_009873617.1.27753 WP_009873617.1.27980 WP_009873617.1.31128 WP_009873617.1.38181 WP_009873617.1.38794 WP_009873617.1.40464 WP_009873617.1.40808 WP_009873617.1.42718 WP_009873617.1.42889 WP_009873617.1.43504 WP_009873617.1.45552 WP_009873617.1.48923 WP_009873617.1.49465 WP_009873617.1.51159 WP_009873617.1.53299 WP_009873617.1.5416 WP_009873617.1.58046 WP_009873617.1.58308 WP_009873617.1.5967 WP_009873617.1.60427 WP_009873617.1.61004 WP_009873617.1.6151 WP_009873617.1.61683 WP_009873617.1.62239 WP_009873617.1.62489 WP_009873617.1.62968 WP_009873617.1.64162 WP_009873617.1.65182 WP_009873617.1.71307 WP_009873617.1.71686 WP_009873617.1.72164 WP_009873617.1.79775 WP_009873617.1.83525 WP_009873617.1.83642 WP_009873617.1.85365 WP_009873617.1.87079 WP_009873617.1.92427 WP_009873617.1.93600 WP_009873617.1.97423 WP_009873617.1.99598 YP_001654505.1.27483 gi|527325696|ref|YP_008351889.1| gi|568111428|ref|YP_008921026.1| gi|478449696|ref|YP_007719253.1| gi|478462335|ref|YP_007738156.1| gi|478452396|ref|YP_007720144.1| gi|166154387|ref|YP_001654505.1| gi|478450597|ref|YP_007721039.1| 315277.CTA_0193 471472.CTL0429 471473.CTLon_0424 580049.JALI_1711 672161.CTB_1711 gi|478453310|ref|YP_007717472.1| gi|478448798|ref|YP_007723721.1| gi|478470440|ref|YP_007729081.1| gi|478458726|ref|YP_007731910.1| gi|478466831|ref|YP_007718363.1| gi|527323637|ref|YP_008349833.1| gi|527319870|ref|YP_008346070.1| gi|478451496|ref|YP_007714802.1| gi|478465032|ref|YP_007741714.1| gi|478447896|ref|YP_007721930.1| gi|76788899|ref|YP_327985.1| gi|482545535|ref|YP_007851453.1| gi|478471331|ref|YP_007739934.1| gi|478469541|ref|YP_007722821.1| gi|478467732|ref|YP_007742605.1| gi|478464132|ref|YP_007740824.1| gi|237802601|ref|YP_002887795.1| gi|166155262|ref|YP_001653517.1| gi|478447004|ref|YP_007715692.1| gi|527327546|ref|YP_008353737.1| gi|237804523|ref|YP_002888677.1| gi|482546478|ref|YP_007852394.1| gi|478463234|ref|YP_007739046.1| gi|478454202|ref|YP_007716581.1| gi|527328471|ref|YP_008354661.1| gi|527317988|ref|YP_008344190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]