SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|527318429|ref|YP_008344631.1| from Chlamydia trachomatis RC-L2s46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|527318429|ref|YP_008344631.1|
Domain Number 1 Region: 579-688
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000142
Family Thioltransferase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|527318429|ref|YP_008344631.1|
Sequence length 692
Comment thiol:disulfide interchange protein [Chlamydia trachomatis RC-L2(s)/46]
Sequence
MIRQWYGFFLCLLFSYTSCFGVEENSGRATPTVELVSESEQAVEGEVLRIGVLIAIPEGE
HIYWKNPGKLGMPLRISWDLPSGCRLLEEHWPTPEIFEEDGVVYFGYKHSTMVVADIRVS
KEIETRPLEIKAQVEWLSCGASCLPGSSSRVLVIPIDQGPLIPNSKETFTFSRALAAQPR
PLDAAIKISYQPDGLDVLVPAGKADRATQAWFIAENTRDFAYAQEVPLEQATTYIWKLKH
PEGNMPKGVGLSGILIFKDDAGKVVASYQVEENQVEQLSALSWGFLSILLMAFIGGILLN
IMPCVLPLITLKVFSLIKSAADHHSSSVIGGIWFTLGAIVSFWGLAFCAFLLKVLGQNIG
WGFQLQEPMFVAVLIIVFFLFALSSLGVFEMGMICLSLGEKLQEEGGASVRKNQIWGAFF
NGMLTTLVTTPCTGPFLGSVFGLVMAVSFVKQLAIFTAIGLGMASPYLLFASFPKMLAIL
PKPGPWMSTFKQLTGFMLLATATWLIWIFGVETSATAVTILLVGLWLAAVGAWILGRWGT
LVSPRNQRLLASVVFIFCILSSLVITSIGVRYFDENVPPAHSFDWQSFSPEKLADLREKG
IPVFVNFTAKWCLTCQLNKPLLHANMQAFAAKGVVTLEADWTKKDPKITEELARLGRASV
PSYVYYPAGNKAPLILPERLSQSALEEMVFSQ
Download sequence
Identical sequences A0A0E9DMP2 A0A0H3MLI0
gi|478450125|ref|YP_007719682.1| gi|482545978|ref|YP_007851896.1| gi|478451926|ref|YP_007715232.1| gi|478447435|ref|YP_007716123.1| gi|478448327|ref|YP_007722361.1| gi|478465461|ref|YP_007742143.1| gi|527318429|ref|YP_008344631.1| gi|478462765|ref|YP_007738586.1| gi|478463664|ref|YP_007739476.1| gi|527327985|ref|YP_008354176.1| gi|478467260|ref|YP_007718792.1| gi|478471760|ref|YP_007740363.1| WP_009873929.1.100883 WP_009873929.1.101735 WP_009873929.1.11148 WP_009873929.1.11732 WP_009873929.1.17082 WP_009873929.1.18643 WP_009873929.1.22210 WP_009873929.1.25195 WP_009873929.1.27753 WP_009873929.1.27980 WP_009873929.1.38794 WP_009873929.1.40464 WP_009873929.1.40808 WP_009873929.1.42718 WP_009873929.1.45552 WP_009873929.1.48923 WP_009873929.1.49465 WP_009873929.1.51159 WP_009873929.1.53299 WP_009873929.1.5416 WP_009873929.1.58046 WP_009873929.1.58308 WP_009873929.1.5967 WP_009873929.1.60427 WP_009873929.1.62489 WP_009873929.1.64162 WP_009873929.1.71307 WP_009873929.1.79775 WP_009873929.1.83642 WP_009873929.1.85365 WP_009873929.1.97423 WP_009873929.1.99598 YP_001654927.1.27483 471472.CTL0859 471473.CTLon_0852 gi|527326137|ref|YP_008352330.1| gi|478454631|ref|YP_007717010.1| gi|339626285|ref|YP_004717764.1| gi|478452825|ref|YP_007720573.1| gi|527327059|ref|YP_008353251.1| gi|478469970|ref|YP_007723250.1| gi|478468161|ref|YP_007743034.1| gi|478464561|ref|YP_007741253.1| gi|482546921|ref|YP_007852837.1| gi|527324078|ref|YP_008350274.1| gi|166155684|ref|YP_001653939.1| gi|478470869|ref|YP_007729510.1| gi|166154809|ref|YP_001654927.1| gi|478453739|ref|YP_007717901.1| gi|478451026|ref|YP_007721468.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]