SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383756517|ref|YP_005435502.1| from Rubrivivax gelatinosus IL144

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383756517|ref|YP_005435502.1|
Domain Number 1 Region: 156-582
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 5.49e-122
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0000000000062
Further Details:      
 
Domain Number 2 Region: 15-24,53-172
Classification Level Classification E-value
Superfamily Cytochrome c 3.02e-19
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383756517|ref|YP_005435502.1|
Sequence length 582
Comment cytochrome cd1 nitrite reductase NirS [Rubrivivax gelatinosus IL144]
Sequence
MIRTTTVAGAVALLATLLASPAVLAQGAASDAAETHGTMPPAQQSYQGAPSPLANEPMYQ
SANPKAPKMTQAEFELGRKTYFERCAGCHGVLRKGATGKPLTPDITLSKGTDYLKVFISY
GSPAGMPNWLTSGELDEKTVDIMARYIQQDPPQPPEFGLAQMKQTWKVLVPPEKRPTRKM
NKFNIENIFSTTLRDAGEIALIDGDSKQIISVIKTGYAVHISRTSASGRYLFVIGRDAKI
NMIDLWMEHPETVAEIRVGLEARSVETSKYKGYEDKLAIAGTYWPPQFTIMDGDTLEPKK
IVATRGMVVGTQEYHPEPRVASIVASHYKPEFIVNVKETGKTLMVDYSNLDALKMTEIGS
APFLHDGGWDATKRYFFVAANQSNKITVIDAKEDKLAAIVEVGKIPHPGRGANFVHPKFG
PVWATGHLGDETISLIGTDPVKHKQYAFKEVAKLTGQGGGNLFLKSHPKSQHLYVDTPLN
PDPALSQSVAVYDVKNLDKGFTVLPIAQWAGLGDDGAKRVVQPEFNKAGDEVWFSVWSAK
NKQSALVVVDDKTLKLKAVIKDPRLITPTGHFNIFNTQHDIY
Download sequence
Identical sequences E0D3V9 I0HLW6
gi|383756517|ref|YP_005435502.1| WP_014426879.1.89159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]