SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383756520|ref|YP_005435505.1| from Rubrivivax gelatinosus IL144

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383756520|ref|YP_005435505.1|
Domain Number 1 Region: 18-392
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.7e-71
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383756520|ref|YP_005435505.1|
Sequence length 395
Comment heme d1 biosynthesis protein NirF [Rubrivivax gelatinosus IL144]
Sequence
MKRRDLLAALALPPLAALVPGCAQTPALRGTGDLGLVVERAAGSVVVVDTSARAVLGRVG
GLGDLSHASAVFSRDGRYAYVFGRDGGLTKVDLLERRIAGRVMQAGNSIGGAISADGTLV
AAQNYTPGGIKVFDAATLALVADVPAEVAPGQRSRVVGLVDLPGRRFAYSLFDADAIWIT
DCSDPAAPKTTKLGGIGRQPYDALVTPDGRHYVAGLFGEDGLALVDLWAEPLRARKVLSG
YGRGQEPLPVYKMPHLRGWAVAGRRAYLPAIGRHEVLVVDTESWQEVGRIAVAGQPVFVM
ARPDGRQVWVNFAVPDYDRVQVIDTLTQQVVQTFSPGKAVLHLEFTPRGDAVWISSRDDH
RVSVVDTASFTTLATLAVDSPSGIFFTSRANRLGM
Download sequence
Identical sequences E0D3W2 I0HLW9
WP_014426882.1.89159 gi|383756520|ref|YP_005435505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]