SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383756525|ref|YP_005435510.1| from Rubrivivax gelatinosus IL144

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383756525|ref|YP_005435510.1|
Domain Number 1 Region: 115-525
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 3.53e-77
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00011
Further Details:      
 
Domain Number 2 Region: 6-116
Classification Level Classification E-value
Superfamily Cytochrome c 9.31e-19
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383756525|ref|YP_005435510.1|
Sequence length 532
Comment heme d1 biosynthesis protein NirN [Rubrivivax gelatinosus IL144]
Sequence
MRRRALKLLLAAAVVWIGWDVAHAQAASEPAAALAAPVLYTTHCAACHGAQRTGAMGPAL
LPESLERLRPAEARKVIAQGRPATQMAGFADKLSAAEIDALAAWVYQPVNPAPAWSEADI
RASREETPGAAKLPAKPVWRADPMNLFVVVEGGDHHVSLVDGDRFEVIHRFASRYALHGG
PKFTPDGRYVFFGSRDGWITKYDLWNLTVVAEVRAGLNMRNIAVSGDGRWVMAANYLPKT
VALFDAELKLVKTIPAQTLDGKQASRVSAVYDAAPRHSFVVAMKDIPEVWEISYDPKAEP
IHDGYVHDYKMGEAIATPGFLNPRRTVLDEPLDDFFFDQGYRHLLGATRPKADGQGASAQ
VVNLDIRRKVADLPIAGMPHLGSGITFGWNGTTVLASPNLKGGAIDVIDMKTWKPVKTIP
TPGPGFFMRSHEATPYAWTDSMMSPTAKDTLTLIDKATLSPVATIREPGKTLAHVEFTKD
GRYALASVWELDGALVVYDARTLKEVKRLPMSKPVGKYNVWNKITRSEGTSH
Download sequence
Identical sequences E0D3W7 I0HLX4
WP_014426887.1.89159 gi|383756525|ref|YP_005435510.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]