SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383756355|ref|YP_005435340.1| from Rubrivivax gelatinosus IL144

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383756355|ref|YP_005435340.1|
Domain Number 1 Region: 339-662
Classification Level Classification E-value
Superfamily Subtilisin-like 2.23e-66
Family Subtilases 0.0000163
Further Details:      
 
Domain Number 2 Region: 90-174
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000327
Family Collagen-binding domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383756355|ref|YP_005435340.1|
Sequence length 883
Comment peptidase S8A family protein [Rubrivivax gelatinosus IL144]
Sequence
MRRAALLAALTVLAACGGGGGGGGDDSAAGYSVSGTLSVSANLVVDSDTNDPNQTRIAND
DSAQAQPIAATSQVMGTVNVPRAGADGASHAAGDPSDFFRVTLAAGQTLQLDFTADTAAN
DLDLYVYRRVGDADVLVGSSTGSSLSECVRVTEPGEYVVQVEAYDGASLYNLRIAAAGAG
GSCANATSSVAARRLVPGQLIAGLAEGSGRVRAAGALVSAQPLSLLKGRVAPGRLGLMAL
ADDEKSRRRGLLALAGADEATLRAARRPAWMDRLSPDSRLQVETLQYAKRLAASGAFDYV
TVNRPLHATALVGSFPPDDPRYALQRWHYEQIALPAAMDALVALSPQPSQRPIVAVLDTG
IVADHPDLAGQITAGYDFVQDAASAGDGNGLDADPDDFRAADSQPSFHGTHVAGTVAAAT
YNGTGVAGVAPMAQVMPIRVLGKGGEGTFYDILQGLRYAAGLANDSASVPARRADVANLS
LGASGVACDSASATLIAQVRAQGTMIVAAAGNESDRDSGRVAAVDYPANCAGVLAVTATD
AQRGVAYYANGGDELALAAPGGDMRVATTGSGLPDGIYSTLATFDAGGVRTPTYGQYQGS
SMATPHVAAVLALMRWVHPAITPEQVDALLQAGELSDDAGATGHDSQYGWGIVDAAKAVR
AAIALKNGGWAPGIQGVVEAQPSALDFGTTTSSLEFTLRVTAPTDETVGAVGDDSAAVSV
APVAVDAAGLGRYRVTVDRSGLAAGVYTPQITVMTSRRTLTLPLSIQKLDATSTPDIGPI
YVLVYDATGDKVLKQAMLRASGGVYRYRIDGLDAASVTVLAGSDYDNDGVVCSSGEACGA
YPVLGVSLTPVPLGADRSGLDFLLSAVGSGNAEAASRAASRKR
Download sequence
Identical sequences I0HLF4
gi|383756355|ref|YP_005435340.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]