SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478430061|ref|YP_007538673.1| from Helicobacter pylori OK310

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478430061|ref|YP_007538673.1|
Domain Number 1 Region: 294-418,720-828
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.49e-21
Family ABC transporter ATPase domain-like 0.036
Further Details:      
 
Domain Number 2 Region: 12-101,133-259
Classification Level Classification E-value
Superfamily PHP domain-like 0.000000000275
Family PHP domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|478430061|ref|YP_007538673.1|
Domain Number - Region: 306-366,530-557,596-668
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.069
Family ABC transporter ATPase domain-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478430061|ref|YP_007538673.1|
Sequence length 870
Comment ATPase [Helicobacter pylori OK310]
Sequence
MDNEDKNKGSSWHKWDLHAHTPYTHLNKAYQCSEDDFIQELCKNEIACIGLTNYFKFDEK
EFALKEKIEKKGIKVFYNLEVRLDYKNNKNEFLDFHIIFSDEILSDNIKRFLSDMKATID
GTKKRLADLEKDDFNKAVVNFDQLLECLEEESLNLRGKYLLGFLSRGHGSIECKFLEKGG
RNETIYKKVIDKSRFLIHSSNNQENLKKDREFWLKHNKPLLQSSDAHKEDSIGKKYTWIK
AEKTFEGLKQIIYEPKTRVSIDKSQDPLHKIDYVGLCFDGEVKITNEKGDTPFCYAGFNK
TLFFSPNFTCVIGGRGSGKSTLLQLIVSKLYDKSLVKGLEHETIQEYIEIQPDTVDSVEY
LAQNEVEEFATNVSKFTEAIFNRIDSKSSGNLKELEKQITENIKKFDEQIAYWQKKTKLE
EQLKESEKIRKKYQNIIDTFTDKDYLDKRDKLQEKRKVLIDLRQSKEGVLTFIKELKRVV
NFESKENMEEKNSYDKVYNQLKQNICKKLEEIDTDIKNGRFDSDEENIEKLESEQQTLRQ
EIGEFLKEKGVIDENIGDLERANYQLADIEREITDLEREKKEITNKIEGFSYGDIDKNIE
EFKDQINEELSKINSAFKEISKNHKEVKPITIKYRLNEYIFEGVFEDFDKWVDKGFNTQK
HQSKIKEYLKEIELKDVTGMQHAGFIEELYNSIDNKKAAFYKTMKCIFDREIHFQIYRLL
ILKHLRNVEKYKIFEVRYDKRALNETSFGQKCTAVLVVLLSLGNNPIIIDEPEAHLDSAL
IANYLVTLIKKQKQKRQIIFATHNANFVLNADAELIIQLKNEDNKIVAQSFMIESDDYKE
DLLKLEGGEKAFKDRERKYGITKDKTKNKE
Download sequence
Identical sequences M4ZP45
WP_015429287.1.48764 gi|478430061|ref|YP_007538673.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]