SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lus10002614|PACid:23168824 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10002614|PACid:23168824
Domain Number 1 Region: 37-135
Classification Level Classification E-value
Superfamily Cupredoxins 1.38e-31
Family Plastocyanin/azurin-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lus10002614|PACid:23168824
Sequence length 136
Sequence
MGYHSKSLSHQDLLALILIIAAVAVTPATILAHKYNTFPVGDAEGWTVGPNFQKWAEGKQ
FHVGDQLVFKYEKGDHNVYKVTESEYEKCKVPTDKSKVLNSGNDLVMLKSKGKLYYLCGE
PGHCAKGQKIAIDVMG
Download sequence
Identical sequences Lus10002614|PACid:23168824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]