SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lus10016621|PACid:23143923 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10016621|PACid:23143923
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily Cupredoxins 0.000000000000791
Family Plastocyanin/azurin-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10016621|PACid:23143923
Sequence length 125
Sequence
MLSVFVYSSNESDSVLLVNSIAYSNCILSHPILRLENTTFQLDRPGLFYFISGQAGSCIA
GQKLVVRVMDDEQQDTGPSPAPGSKDLIWDGLNWPPAINSTVKTTIASYFITALGGVLVI
LYLLM
Download sequence
Identical sequences Lus10016621|PACid:23143923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]