SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lus10001620|PACid:23175428 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10001620|PACid:23175428
Domain Number 1 Region: 564-743
Classification Level Classification E-value
Superfamily Sec7 domain 6.93e-68
Family Sec7 domain 0.00000378
Further Details:      
 
Domain Number 2 Region: 1017-1435,1521-1617,1662-1704
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000000644
Family Armadillo repeat 0.052
Further Details:      
 
Weak hits

Sequence:  Lus10001620|PACid:23175428
Domain Number - Region: 69-200,245-269,309-531,1039-1197
Classification Level Classification E-value
Superfamily ARM repeat 0.000504
Family HspBP1 domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10001620|PACid:23175428
Sequence length 1710
Sequence
MSAPVALGGSSRCGRVLGPSLDKIIKNAAWRKHSHLVTSCKSALDKLQSLSDLPNHDPDS
PLFCIPAADSPLLLQPILLALDSNHSKVAEPALECAYKLFSLSLIRGEADPASISPSLIL
RLLDAVCRSCSIGDEVLELSVLRALLAAVRSPCLSISGEGLASIIKTCYNVYLGGTNGTN
QICAKSVLAQIVLIVFTRVEEDSMDVVLRTVSVGELLEFTDKNLNEGSSIHFCQNFINEV
MSAAAAEDIHLPVHVPSPDVKQENGGATDGSAAGDDVAKVADDKGESDNGAQPQPVGADT
DAAGAEATGDSKIREDGFLLFRNLCKLSMKFSSQENPDDHILLRGKTLSLELIKVIMNTG
GPLLRNNERQNSALSVMAVFQLQCSIFIILLSKFRSGLKEEIGIFFPMLILRVLENVNQP
SFLQKMTVLNFLEKIFLDPQLIIDLFVNYDCDVESPNLYERTVNGLLKTALGPPPGSTTT
LSAAQDITFRHESVKCLVIIIKSMGTWMDQQLRIEEAYLPKSTEIYTSIENYSNPSGEDG
SIPDYDLHTEVTSETSDAATLEQRRAYKMELQKGISLFNRKPSKGIEFLINSKKIGDSAE
EVAAFLKNTSGLNEIVIGDYLGERDEFCLKAMGFGESIRYFLRGFRLPGEAQKIDRIMEK
FAERYCKCNPNSFTSADTAYVLAYSVIMLNTDAHNNMVKDKMSKADFIRNNRGIDDGKDL
PEEYLSTIYDQIVKNEIKIKADSVPQAKQENSLNKLLGLDGILNLVTWKQAEEKPLGANG
LLIRHIQEQFRAKSGKAESVYHVVTDAAILRFMAEVCWGPMLAAFSMTLGQSDDKLATSQ
CLQGFRYAVHVTAVMGMQTQRDAFVTSIAKFTYLHCAADMRQKNVDAVKAIIAIAIEDGN
HLQESWEHILTCLSRIEHLQLLGEGAPPDASFLTGSNNDPDEKALKSMGSYPSLKRKGSL
QNPAVMAVVRGSSYDSTGLGLNTLGPVTPEQINSFISNLNLLDQIGHFELNHVFANSQML
NSEAIVAFVRALCKVAISELQSPTDPRVFSLTKIVEIAHYNMNRIRLVWSRIWNVLSDFF
VSVGLFENLSVAIFVMDSLRQLAMKFLEREELANYNFQNEFLRPFVIVMQKSGSTEIREL
IVRCISQMVLTRVNHVKSGWKSVFMVFTAAAADERKNVVLLAFETMEKIVREYFPYITET
ETTTFTDCVRCLTTFTNSRFNSDVSLNAIAFLRYCAVKLAEGGLTCNEVKKVDDSSKPVM
NEDTSDVQNVHDKDDHASFWFPLLTGLSRLTSDPRSAIRKSALEVLFNILSDHGHLFSRV
VWMDIFTSVVFPIFNGLCDRRDIDSKGDQDSATPAHLEGGSWDSDTSSLASQCLVDLFVR
YFDVVRSQLHHLMAILTGFIRSPVHGPASTGVSALLRLAGELGSRLSDDEWAQIFVALKE
AAALTMPGFMKVFRSLDDIEMAIDPQSYADIDVASDPGFTQGDIEEDRLQTAAYVASRVK
SHIAIQLLITQVAIDLYRTHLKYLSESNISIIIEMFRTVASHARDLNCETFRLKKLQRAC
SILEISDPPMVHFENESYQNYLSLLQDLIVDKPWACKDINVDSRLVEVCVEILQIYLKCT
ARPPSRTLNRPVTRSVLPLGAAKKEELVARTSLLVSALQGLSGLDRESFGKHVMEFFQLL
VDLVKSEHSSGEVQRALSNIFASCIGPIVM
Download sequence
Identical sequences Lus10001620|PACid:23175428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]