SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lus10002852|PACid:23181328 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10002852|PACid:23181328
Domain Number 1 Region: 25-125
Classification Level Classification E-value
Superfamily Chaperone J-domain 7.85e-29
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 191-302
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000117
Family Thioltransferase 0.05
Further Details:      
 
Domain Number 3 Region: 426-551
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000187
Family Thioltransferase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lus10002852|PACid:23181328
Sequence length 560
Sequence
MNINGGRLALAAILGLSLILLTEQTKNSDPYKVLGVEKNASQREIQKAFHKLSLQYHPDK
NKSKSAQAKFAEINNAYEILSDEEKRKHYDLYGNDQGNPGFDAGYPDPRRGYAHFTGGQG
SNGFGFKPGEWQNMGGEGGSQSFSFSFGGGINDILSNFFGGNSWDAQSGGFGGSTQSQGR
SQYGSRSSPKNIRDINSQVFKKEIIDLGMTWLILSYTPSLRDTEYYESIIQEVSDPLQGA
LKAGSINCETQKSLCTELSITPRREPRVFLYSYKDQNSKGSLVECTGDLVPKNLKAFCQD
HLPRFSTRINLKAISSNVGKLPRVLLLSTKRDTPVMWRALSRLYHKRFVLNDAEVHDVND
PMVKELGVDKLPAVVGWLSNGEKHVLKTGISAKDLKSGIQELSRLLDGFEKKNKKVPNSS
SGEEKVPLLTGSNYDDICGEKIPVCVIGAFRSSRTRDKLESILSAVSQKSLSRRPSSVAG
SPDAVSYALLDAGKQPTFMTAFDRQGFKSSENTLIAYKAKKGKFVKFEGEMSIEPVEAFI
SSVLNGDVQFTKTRQKPVIK
Download sequence
Identical sequences Lus10002852|PACid:23181328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]