SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lus10003380|PACid:23175210 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10003380|PACid:23175210
Domain Number 1 Region: 25-127
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.22e-29
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 199-305
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000325
Family Thioltransferase 0.078
Further Details:      
 
Domain Number 3 Region: 429-554
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000141
Family PDI-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lus10003380|PACid:23175210
Sequence length 563
Sequence
MNINGGRLALAAILGLSLILLTEQAKNSDPYKVLGVEKNASQREIQKAFHKLSLQYHPDK
NKSKSAQAKFSEINNAYEILSDDEKRKNYDLYGNDQGNPGFDAGYPDPRRGGYTHFTGGQ
GSNGFGFKPGEWQNMGGEGGSSQSFSFSFGGGINDILSNFFGGNSRDPQSGGFGGSTQSQ
GRSQYGSRSSPPKGIRDINSQVYKKEIIDQGMTWLILSYTPSLRDTEYYESIIQEVSDPL
QGALKVGSMNCETQKLLCMELSITPRREPRLFIYTYKDKNNKGSLVEYTGDLVPKNLKAF
CQDHLPRFSVRIKLKSFSSNVGKLPRVLLLSTKRDTPVMWRALSGLYHKRFVLNDVEVHD
VNDAMVTELGVDRLPAVVGWLSNGEKHVLKTGISAKDLKSGIQDLSRLLDGFEKKNKKVP
NSSFGEEKVPLLTGLNYDDLCGEKIPVCLIGAFRTSRAREKLESILSAVSQKSLSRRPSS
VAGSRDAVSYALLDAAKQPTFMSAFDRQGFKSSDYMLIAYKPKKGKFVKFEGEMSIEPVE
AFISSVLNGDVQFTKTRQKPVIK
Download sequence
Identical sequences Lus10003380|PACid:23175210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]