SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lus10009244|PACid:23160181 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10009244|PACid:23160181
Domain Number 1 Region: 616-716
Classification Level Classification E-value
Superfamily Sec7 domain 3.92e-45
Family Sec7 domain 0.0000308
Further Details:      
 
Domain Number 2 Region: 373-547,833-895,1049-1316,1344-1390
Classification Level Classification E-value
Superfamily ARM repeat 1.39e-16
Family Exportin HEAT-like repeat 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10009244|PACid:23160181
Sequence length 1701
Sequence
MASSEADSRLSQVVAPALEKIIKNASWRKHSKLAHECKSVLQRLNSPRKQQQQSLSSSAA
DPEASVPGPLHDGGTFEYSLAESESILGPLISACGTGVLKIVDPAIDCIQKLIAYGYLRG
EADPAEGAEVALLARLIGSVCKCYDIGDDAIELSVLKALLSAVTSVSLRIHGDCLLQIVR
TCYDTYLGSNNVVNQTTAKASLIQILVIVFRRMEADSSTVPVQPIVVADLMTPVERSDGD
GSMTMFVQGFITKIMHGIDGVLNAGAPSKIAVGHDGAFETTTVETTNPTDLLDSTDKDML
DAKYWEISMYKTALEGRKGELADGEVERDEDLDVQIGNKLRRDAFLVFRALCKLSMKTPP
KEASADPQLMRAKIVALELLKILLENAGAVFRTSDRFLGAIKQYLCLSLLKNSASSLMIV
FQLSCSIFVSLVSRFRAGLKAEIGVFFPMIVLRVLENVAQPNFQQKMIVLRFIEKLCVDS
QILVDIFINYDCDVNSSNIFERMVNGLLKTAQGVHPGTAPSLMPPQEATLKLEAMKCLVA
VLKSMGDWANKQLRIADPSSANKQDAVENSPETGSFSTINGNGEVPAQGSDFPSETSIET
SDVSLIEERRAYKLELQGFRLPGEAQKIDRIMEKFAERYCKCNPKVFISSDTAYVLAYSV
ILLNTDAHNPMVKNKMSADDFIRNNRGIDDGKDIPEEYLRSLYGRISTNEIKMKEDAFDV
QQIQSTNSNRILGLDSILNIVVLKRGEDRHVETSDDLIRYMQEQFKEKAQKSESAYYAAT
DVVILRFMVEVCWAPMLAAFSVPLDESDDEVVIGLCLEGFRCAIHVTAVMSLKTHRDAFV
TSLAKFTSLHSPADIKQKNVAAIKALVTIADEEGNFLQEAWEHILTCVSRFEHLHLLGAG
ALPDATFFSFPQNESVKTKPAKSSILPVLKKKGPGRLQYAAAAAVLRGSYDSASIGGNVS
VSVSTDQMNILVSNFTMLEQAGSSEMNRIFTRSQKLNSEAIIEFVKALCKVSIEELRSAS
DPRVFSLTKIVEIAHYNMNRIKLVWSSIWHVLSDFFVTIGCSENLSISIFAMDSLRQLSM
KFLEREEFANYNFQNEFMKPFVIVMRKSSAVEIRELIIRCVSQMVLSRVKHVKSGWKSMF
MVFTTAAYDDHKNIVLLAFEIMEKIICDYFPYMTETETTTFTDCVNCLIAFTNSRFDKDI
SLNAIDFLRFCASKLAEEDLQSTSGNKEIEALPSTSSSSLNTVKDGEQENEHIDYREDHL
YFWFPLLAGLSELSFDPRPEIRTSALQVLFDTLRNHGHLFSLPLWERVFESVLFPIFDYV
WHAIDPTGGDSPGQGIDTDTGGELDQDAWLYETCTLALQLVVDLFVKFYNTVNPLLRKGL
KLLVSFIRRPHQSLAGIGIAAFVRLMSNAGYMFSDEKWREVVFSVREAGNTTLPDFSYLV
SGETSVPRNGHAIISEENNVENGESGDDPERLITERLHAAISVAKCRAAVQLLLIQAVME
IYSMYRPQLSARNTLVLFDSLHDVASHTHKINTDAHLRLKLQELSWTAQMQDPPLLRLEN
ESFQICLTFLQNLILDRPPGYDETEVESCLVSVCQEVLQFYIGTARSRQTHSPSEPRQLL
LRSLIPLGSGKRRELAARGPLIVSTLRAICSMGEASLGRNLCGLFPLLSNLISCEHGSKE
VQVALSLMLRESVGPVLFQSC
Download sequence
Identical sequences Lus10009244|PACid:23160181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]