SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lus10009305|PACid:23141890 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10009305|PACid:23141890
Domain Number 1 Region: 676-967
Classification Level Classification E-value
Superfamily BEACH domain 1.11e-124
Family BEACH domain 0.0000000115
Further Details:      
 
Domain Number 2 Region: 1089-1158,1191-1305,1347-1394
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.11e-31
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 3 Region: 558-666
Classification Level Classification E-value
Superfamily PH domain-like 3.26e-23
Family PreBEACH PH-like domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10009305|PACid:23141890
Sequence length 1419
Sequence
MDANGNWIELPLVKKSVQMLQALLLDESGLGGGLGIGGGSGTGMGAMTALYQLLDSDQPF
LCMLRMVLLSMREEDNGETSVLTRNVSMKESNTMRQPHSALLWSVLSPVLNMPISDSKRQ
RVLVASCVMYSEVWHAIGRDKKPLRKVYLESILPPFVAVLRRWRPILAGIHDLPTADGLN
PLAVDDAALAADALPVEAALKMISPDWAAAFASPPAAMALAMIAAGASGGETLAPQAVSH
HLRRDSSLLERKKAKLQTFSSFQKPLEGSNRTPGLPKDKAAAKAAALAAARDLERNAKIG
SGRGLSAVAMATSAQRRTASDRDRVTRWTISEAMGVAWLECLQPADTRSVYGKDFNALSY
KFIAVLVASFALARNMQRLEVDRRAHVDVVARHHFLRGNRAWKKLIHHLIEIKSLFGPFA
MHFDNPERIFWKLDLMESASRMRRCLRRNYDGSDHFGAAANYEDEMKTVHREENVPLLAA
EAISMEGVKEDEEHEMGNLDSAADDTRISEDNQSGVSGTTDQNAHQPLESSESQLVNVQV
LDRTSSMAIGYVPSELDERIILELPSSMVRPLRVIQGTFQVTSRRMNFIVDGIEGNCLEG
TESSEVANQEKDYSWSMSSLHQIYSRRYLLRRSALELFMVDRSNFFFDFGSTEGRRSAYR
AIVQLRPPHLNNIYLATQRPEQLLKRTQLMEQWARWEISNFEYLMQLNTLAGRSYNDITQ
YPVFPWVLSDYTSNSLDLSKPSSYRDLSKPVGALNPERLKKFQERYASFDDPVIPKFHYG
SHYSSAGTVLYYLGRIEPFTTLSIQLQGGKFDHADRMFFDISSTWNGVLEDMSDVKELVP
ELYYLPEMLTNENSIDFGTTQLGGKLDSVKLPPWAENPVDFINKHRIALESENVSEHLHE
WIDLIFGYKQRGKEAITANNVFFYITYEGTVDIDKIADPIQQRATQDQIAYFGQTPSQLL
TVPHLKRMPLSDVLQLQTIFRNPKEVKPYPIPAPDRCNLPAAAIRASSDRVVIVDIKAPA
AHVAQHKWQPNTPDGQGSPFLFEHGKTSANSAGGAFMRMFKGPAGSGDDCQFPQALAFPS
SGIRSTAVVSITHDNEVITGGHADNSIKLISADGAKTLETAVGHCAPVTCLALSPDSNYL
VTGSRDTTVLLWKIHKASSLTSSTVDQATNSNTPTSGSNSLTEKNRQPRIEGPIHVLRGH
RREILCCSVSSDLGIVVSCSESSDLLVHSIRRGRLIRRLVGVEAHAVCLSPEGIILVWNK
IERNLSTFSVNGVSIAKANLPLSGDVSCIEVSADGRSALVGMNCSGEADNTSNINKDFRI
WKQGSEERDPDSDEIQETKRLDVPSPSICFMDLHTLQVFHVLKLGEGQNITALAMNDDNT
NLVLSTADKQLIIFTDPALSLKVVNQMLKLGWEGDGLMV
Download sequence
Identical sequences Lus10009305|PACid:23141890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]