SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lus10013425|PACid:23155090 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10013425|PACid:23155090
Domain Number 1 Region: 935-1092
Classification Level Classification E-value
Superfamily VC0467-like 9.29e-20
Family VC0467-like 0.0016
Further Details:      
 
Domain Number 2 Region: 733-867
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000246
Family PDI-like 0.03
Further Details:      
 
Weak hits

Sequence:  Lus10013425|PACid:23155090
Domain Number - Region: 649-703
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00126
Family PDI-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Lus10013425|PACid:23155090
Sequence length 1098
Sequence
MKHKVVGLLLSLLSVFVLTAAVESSQPSGIDRNLEGLGRWHILDRRNYSSQIRMHPNIIL
IVSVPWSGESRSLMREISDLVSVRNEEFGSLVLMYLHRNREKMLADAIGAAGEGRVTVFY
LHHSVPYKYKGRFGAVSILYSISPYLSHEPEEIPLKELKSEHELRTFVESTDKAVLLMEF
CGWTRQLLSRAYKNETHSSGFQFQGDFAGANGEIERPPVYLGQENQKVAGDEKAMLTCGT
ESAFSGIPSLGEFRSGNDSFTGQEDESWGAEKAKSGTGFSCTYEQFQQFDSVFSKFMAVA
REFFLPNEKHRFGLVSEQSLLSYLGIGDPGSWAVMLACNGCQTPSRILKNDDDIKTTLQL
DKSVVIELEGNGEDADPTFPSNKPSVVLFVDRLSDLSEMRRKSREALHQFRDLAFHHQLP
DSTRHQNDDRSESSYNQKPQKLHVLSSGHPALKLSSSAQRVNLKDKMSIMVVNDAKHALL
ENVQVDFQGKSLLEILNFVVQQKKEATLSSVAKEAGFQLLSQDQSIKPDLLPTDGEVEAT
HDSSKSSKLSPTTRSDNWDKDLALEERSSYVGSPQVVEKSAYVVTSDDPIKLDKLLSDVE
VSVLETMKLQPELYPSVGTSSEELEFGRFHGSFLFSDGNYRLLTALTGETRIPSLVIMDP
ASQQHYVLPGNIDFSYATIESFVDRFLNKTLVPFQLSESEPASSREGPYPPFVNQNFHEV
DSIPRVTAHSFHEMVIGFNKSDNENTAGAWNEDVLVLFSNIWCGFCQRMDLVVREVFRAI
KGCMNVLKIGSSIRDPIFSCSSEVKFPKIFLMDCTLNDCSLILRSMGTRDVYPALLLFPA
EVKVAIPYEGDATVHKIIEFIVNHSSDSEHLTNENGTLRTVFGKRGTVEKLVKDPSVTTK
LAKDAYVEPQEVILEHRATEKAVTYSGTGSITSSQPQVVVGSILTATEKITSQPFDNSQV
IVVAADEKEGFQGLIYNKPLGWESVRSLEEGLKVLKEAPLSFGGPLVISGMPLAALTREA
IEDDDDELPEVAPGVYFLNQQATLDEIEAIRAGNQTVSDYWFFLGFSSWTWEQLFNEIAA
GSWDVNERGIEYLDWPAR
Download sequence
Identical sequences Lus10013425|PACid:23155090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]