SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lus10016272|PACid:23142691 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10016272|PACid:23142691
Domain Number 1 Region: 96-129
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000013
Family CCCH zinc finger 0.002
Further Details:      
 
Domain Number 2 Region: 246-277
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000131
Family CCCH zinc finger 0.0013
Further Details:      
 
Domain Number 3 Region: 151-225
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000013
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 
Domain Number 4 Region: 37-63
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000929
Family CCCH zinc finger 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Lus10016272|PACid:23142691
Sequence length 281
Sequence
MDPTRKRGRPGAVVSSSNGGFKKSRQEMDSLAIGVGSKSKPCTKFFSKSGCPFGEGCHFL
HHVPGGYNAVAQIMNRPSKPKNVPPSQPPSNGSSTPQAIKTRMCKTYNTAEGCKFGDKCH
FAHGEWELGLPTVLSHNKHCMSHTEPPLPAPTAGFGDTATVKISIAATLAGTIIGNSMQI
CRQTGTKLSIGEHEVDPINLRNIELEGTFEQIGQASSMLTELIANIGGPATGGGRKSSGE
KHHPGSNYKTKICDNFVKGSCTFGERCQFAHGAGEMRKTGV
Download sequence
Identical sequences Lus10016272|PACid:23142691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]