SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lus10016736|PACid:23149162 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10016736|PACid:23149162
Domain Number 1 Region: 183-461
Classification Level Classification E-value
Superfamily Mitochondrial carrier 6.15e-81
Family Mitochondrial carrier 0.0000226
Further Details:      
 
Domain Number 2 Region: 10-182
Classification Level Classification E-value
Superfamily EF-hand 1.95e-35
Family Calmodulin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10016736|PACid:23149162
Sequence length 469
Sequence
MDHVLLALRETKEERDVRIRSLFNFFDVRDTGYLDYAQIETGLSALQIPAEYKYANDLLK
VCDANRDGRVDYHEFARYMDDKEMELYRIFQAIDVEHNGCILPEELWDALVKAGIQIDDE
ELARFVEHVDKDNDGIITFEEWRDFLLLYPHEATMENIYHYWERVCLVDIGEHAVIPEGI
SKQVHRSKYFIAGGIAGAASRTATAPLDRLKVVLQVQTARASLVPAINKIWKADGFLGFF
RGNGLNVIKVAPESAIKFFTYEMLKTVIKDFKGEEATDIGASGRLLAGGLAGAVAQAAVY
PMDLVKTRLQTHPCEGGKAPNLGSLTRDIWVHEGPRAFYKGLVPSLLGIIPYAGIDLAAY
ETLKDMSKTYLLRDTEPGPLVQLGCGTISGAVGATCVYPLQVIRTRMQAQQPNAAAAYKG
MSDVFLRTLEKEGYRGFYKGLFPNLLKVVPAASITYMVYEAMKKRLQLE
Download sequence
Identical sequences Lus10016736|PACid:23149162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]