SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lus10022431|PACid:23171671 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10022431|PACid:23171671
Domain Number 1 Region: 189-467
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.75e-80
Family Mitochondrial carrier 0.0000237
Further Details:      
 
Domain Number 2 Region: 10-188
Classification Level Classification E-value
Superfamily EF-hand 2.66e-34
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Lus10022431|PACid:23171671
Sequence length 475
Sequence
MDHVLLALRETKEERDVRIRSLFNFFDVGDTGYLDYAQIETGLSALQIPAEYKYANDLLK
VCDANRDGRVDYHEFARYMDDKEMELYRIFQAIDVEHSGCILPEELWDALVKAGQLVLAG
IQIDDEELARFVEHVDKDNDGIITFEEWRDFLLLYPHEATMENIYHYWERVCLVDIGEHA
VIPEGISKQVHRSKYFIAGGIAGAASRTATAPLDRLKVVLQVQTARASLVPAINNIWKAD
GFLGFFRGNGLNVIKVAPESAIKFYTYEILKTVIKDFKGEEATDIGASGRLLAGGLAGAV
AQAAVYPMDLVKTRLQTHPCEGGKAPNLGSLTRDIWVHEGPRAFYKGLVPSLLGIIPYAG
IDLAAYETLKDMSKTYLLLDTEPGPLVQLGCGTISGAVGATCVYPLQVIRTRMQAQQSNA
AAAYKGMSDVFLRTVEKEGYRGFYKGLFPNLLKVVPAASITYMVYEGVKKRLQLE
Download sequence
Identical sequences Lus10022431|PACid:23171671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]