SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lus10032522|PACid:23146362 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10032522|PACid:23146362
Domain Number 1 Region: 135-413
Classification Level Classification E-value
Superfamily Mitochondrial carrier 8.24e-81
Family Mitochondrial carrier 0.0000241
Further Details:      
 
Domain Number 2 Region: 66-117
Classification Level Classification E-value
Superfamily EF-hand 0.000000108
Family Polcalcin 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10032522|PACid:23146362
Sequence length 421
Sequence
MVEFREGTSWKSEIAVMMWDVNLLSLVHVEIASSYSKGLGLELGMFQVLIQKQPFGEYPH
VGHQPSIQIDDEELARFVEHVDKDNDGIITFEEWRDFLLLYPHEATIENIYHYWERMCLV
DIGEHAVIPEGISKQVHRSKYFIAGGIAGATSRTATAPLDRLKVVLQVQTTRASIVPAVK
KIWKADGLLGFFRGNGLNVVKVAPESAIKFYAYEMLKNVIKDLKGEEDADIGTSGRLLAG
GMAGAVAQTAVYPMDLVKTRLQTHACEGGKAPKLGTLTRDIWVHEGPRAFYKGLVPSLIG
IIPYAGIDLAAYETLKEMSKTYLLNDSEAGPLVQLGCGTISGAAGATCVYPLQVIRTRMQ
AQQANAAAPYKGMSDVFLRTLEKEGYRGFYKGLFPNLLKVVPAASITYMVYEAMKKHLHL
E
Download sequence
Identical sequences Lus10032522|PACid:23146362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]