SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lus10043022|PACid:23168054 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10043022|PACid:23168054
Domain Number 1 Region: 212-490
Classification Level Classification E-value
Superfamily Mitochondrial carrier 9.81e-81
Family Mitochondrial carrier 0.0000233
Further Details:      
 
Domain Number 2 Region: 35-209
Classification Level Classification E-value
Superfamily EF-hand 2.66e-36
Family Calmodulin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Lus10043022|PACid:23168054
Sequence length 498
Sequence
MSHAVERQQGMPKMEANKSIKKAAAAAVTMDHVLLALRETKEERDVRIRSLFSFFDLANS
GYLDYTQIETGLSALQIPPEYKYAKDLLKVCDANKDGRVDYVEFKRYMDAKELELYRIFQ
AIDVEHSGCILPEELWDALVTAGIQIDDEELARFVEHVDKDNDGIITFEEWRDFLLLYPH
EATIENIYHYWERMCLVDIGEHAVIPEGISKQVHRSKYFIAGGIAGATSRTATAPLDRLK
VVLQVQTTRASIVPAVKKIWKADGLLGFFRGNGLNVVKVAPESAIKFYAYEMLKNVIKDL
KGEEDADIGTSGRLLAGGMAGAVAQTAVYPMDLVKTRLQTHACEGGKAPKLGTLTRDIWV
HEGPRAFYKGLVPSLIGIIPYAGIDLAAYETLKEMSKTYLLNDSEAGPLVQLGCGTISGA
AGATCVYPLQVIRTRMQAQQANAAAPYKGMTDVFLRTLEKEGYRGFYKGLFPNLLKVVPA
ASITYMVYEAMKKHLHLE
Download sequence
Identical sequences Lus10043022|PACid:23168054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]