SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|512552656|ref|YP_008090562.1| from Chthonomonas calidirosea T49

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512552656|ref|YP_008090562.1|
Domain Number 1 Region: 1058-1340
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 7e-57
Family Complement components 0.001
Further Details:      
 
Domain Number 2 Region: 1449-1542
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.000000000000105
Family Alpha-macroglobulin receptor domain 0.0024
Further Details:      
 
Domain Number 3 Region: 711-793
Classification Level Classification E-value
Superfamily Pili subunits 0.000033
Family Pseudopilin 0.017
Further Details:      
 
Weak hits

Sequence:  gi|512552656|ref|YP_008090562.1|
Domain Number - Region: 908-995
Classification Level Classification E-value
Superfamily E set domains 0.000252
Family E-set domains of sugar-utilizing enzymes 0.017
Further Details:      
 
Domain Number - Region: 71-142
Classification Level Classification E-value
Superfamily Transthyretin (synonym: prealbumin) 0.00103
Family Transthyretin (synonym: prealbumin) 0.012
Further Details:      
 
Domain Number - Region: 374-443
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0471
Family Invasin/intimin cell-adhesion fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|512552656|ref|YP_008090562.1|
Sequence length 1552
Comment Large extracellular alpha-helical protein [Chthonomonas calidirosea T49]
Sequence
MGKVALWTAKMVCAFGGALVLFGALGQGKTPASTEGNAVKLSPIEVIARGQDTWICGSRA
GLRLIVKNHDTGQPLPSRVRIALASQSRPHETKLLFEGTTDRYGTLDGSFSTASLTPGTY
QLAVKVKTPIGEDGFETTVRLVRQVKIYLTTDKPLYQPGQIIHMRVLALDAGTLRPLGKT
PITFSVTDGRGNRVFKEEKTLSDFGTVGADFQLADEVNTGVYRITAETLDSSVVRTVEVK
PYVLPKFQITLKPDRGYYQPGQVVTCRLRASYFFGKPVANAEVKATVSTLDVENHELATF
EGHTDAVGSYTFRYRLPETLVGQPMAQGNALVNFNVKVKDTAEQEQEAALSVPVSSQPLH
ITLVPESEKLLPGMPNRVYVAVSTPDGQPVPNAQVHFQFTTAPGSSDQATGVSLQCMTDA
LGIGEIDFVPKSSQGNVICTVSDKQGRKSSTSMNLGTGQNAELLLRVDRPLAKVGDVLQL
TCFSQQKTGTVYLDVLRNHQTILTDAFPIQDGKGTLRLPLSPDMEGTLELHAYQVLPNEL
IPQDVRYAFVLPANDLQLAVSTDKEEYRPGTDAVIRFHVSDKEGHPVAAALGVAMVDESV
FALSDLQPSLAEIYFLLEQQLLTPRYEIHGLTPEQLIPVRNPLPLQERQRAAQLLFAAAR
NGAVGGWPAGFAVVTWNPGPRIPNQSVPGYTLFIDTYEERYAKLIQTIFSRMQESLAQIE
KAIKTYQTQTGQTLVTGVKPMELVDRGLLSKEALRDALGRPYQIDIQGEGADVRIRLTSA
GLDGKFNTGDDFTLWGPQAVLWEMRGRAVFQGAMGGFAGGRMGLAPGSPMVLTMRAANAS
MAKPVGASAPEPRIRSYFPETLYWNPNLITDAQGEATLRLPMADSITTWRMSLLANSLQG
ALGSATKQVRVFQPFFVDLNLPVALTQGDRISLPVTIYNYLPKAQKVRLVLKLQPWFQLE
GSNERKLTVTPEEVTVVHFPIMAKGIGEHSLTVVAYGNQLSDAVRRQIRVEPNGHKTEVI
HNGTLQGTVTQRLMLPPEAVPGASKVLVKIYPGVFSQVVEGLDGLLQMPYGCFEQTSSTT
YPNILILSYLQKTHQVNPAVQMRAEQYIGIGYQRLVTFEVPGGGFSWFGNPPANQVLTAY
GLLEFSDMAKVRDVDQQLLHRTQQWLAEKQRADGSWLEEGPGIAEGIINRQTGALRTTAY
VDWALAESGYTGPQVTNGIAYVERHLDEADDPYTLALILNLLVAARNADPNTSRVAQKLI
SLAHTTDTTAWWEGKTVTFTGAANLGADLETCGLAAYALARWGGDPAFTTKALNYIVQQR
DAAGTWQTTQATVWCMRALLYASSQGAAKGSGLVTVAMNGQKVATLSVTEANHDILQQVE
IQKPLHAGENLLEIHFEGKGALGYQAVNRYYLPWRDTMPPVGPPTEPLALAVHYDRTTLA
QNDTVGVTVTIHNNTDSTVEMPLIDLGVPPGFTVETDGLEEAVKARTIDKYTVAARQIIV
YLQKLTPNQAITLRYKVRALFPVKALTPLSKVYPYYDPEKVTIVPPQTVVVE
Download sequence
Identical sequences S0EY47
gi|512552656|ref|YP_008090562.1| WP_016483983.1.13126 WP_016483983.1.46374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]