SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94968483|ref|YP_590531.1| from Candidatus Koribacter versatilis Ellin345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94968483|ref|YP_590531.1|
Domain Number 1 Region: 11-291
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.45e-72
Family Protein kinases, catalytic subunit 0.00000541
Further Details:      
 
Domain Number 2 Region: 518-702
Classification Level Classification E-value
Superfamily TPR-like 1.82e-22
Family Tetratricopeptide repeat (TPR) 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|94968483|ref|YP_590531.1|
Domain Number - Region: 356-464
Classification Level Classification E-value
Superfamily TolB, N-terminal domain 0.0314
Family TolB, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94968483|ref|YP_590531.1|
Sequence length 821
Comment serine/threonine protein kinase [Candidatus Koribacter versatilis Ellin345]
Sequence
MGAARLIGTTVSHYRIVERLGGGGMGVVYKAEDTRLHRFVALKFLPDELARDSQALSRFQ
REAQAASALNHPNICTIHDIGEENGRAFIAMEFLDGLTLKHTIEERSMEMDRILALAIEI
ADALDAAHAAGIVHRDIKPANIFVTKRGHAKVLDFGLAKVENVAGSQTAIASANTMTAAG
VQEQHLTSPGSTLGTIAYMSPEQARAKDLDARTDLFSFGAVLYEMATGTLPFRGGSTAEV
FKAILDTAPTPMVRMNPDVPPELERIVSKALEKDRNLRYQSANDMRADLARLKRDLDSGR
TSAAVEPASATSVVAAVPPVNRKWLALVGLAVVLVVAAGAGVYFFRGSAVSTQQVTSIAV
LPFVNATNDAANEYLSDGLTGELISSLSQLPNMKVMARSTVFRFKGKQDDPQQIGQTLKV
AAVLTGRITQRGDTMGIDADLVNASDGSEIWGAHYDRKASDLTQVQGDISRDLSNKLKIQ
VGGADQQKFGSAGTSNPEAYRLYLEGRQEWNGRTPEGLKKSIDLYRRAIAADPNYALAYT
GLADTYLVATSYGVGITQQQALSVVDDASKKALELDPTLPEAEATRAMALANQWKFTEAE
QLFRKTLQRSPGNANAHYFFAFNVLLPIGKIDEALAEFRTALSLDPLSTVMNMNYAITLA
VARRYDETSVEFKKTIDRDPKWVPPLYYSSLMHAMTGHFDLANQEMARFRLLAFAFVGRP
NDMPKEDAELFQNYAKHFSTDAKGYLAMNNAGTYPPGFDSIADGAAVYMIAGNREKTLAM
LDQATTERDPDITWIIRLPVFDPLRTDPRFKAIMKRLNLPD
Download sequence
Identical sequences Q1IRP3
204669.Acid345_1455 gi|94968483|ref|YP_590531.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]