SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94969022|ref|YP_591070.1| from Candidatus Koribacter versatilis Ellin345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94969022|ref|YP_591070.1|
Domain Number 1 Region: 303-471
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-48
Family Ribonuclease PH domain 1-like 0.0000228
Further Details:      
 
Domain Number 2 Region: 14-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.56e-47
Family Ribonuclease PH domain 1-like 0.0000223
Further Details:      
 
Domain Number 3 Region: 453-552
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.58e-30
Family Ribonuclease PH domain 2-like 0.0000813
Further Details:      
 
Domain Number 4 Region: 147-238
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.01e-26
Family Ribonuclease PH domain 2-like 0.0011
Further Details:      
 
Domain Number 5 Region: 558-643
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.06e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.005
Further Details:      
 
Domain Number 6 Region: 623-703
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.64e-19
Family Cold shock DNA-binding domain-like 0.00054
Further Details:      
 
Domain Number 7 Region: 244-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000314
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94969022|ref|YP_591070.1|
Sequence length 815
Comment polynucleotide phosphorylase [Candidatus Koribacter versatilis Ellin345]
Sequence
MKPEPKVATVEFTGGKSLSFETGKLAKQAHGSAIVRSGQSVVLATACANADPREGIDFFP
LTVDYREYTYAGGRFPGGFIKREGRPSEKEILTSRQIDRPIRPLFPEGFRCETQVIAMVL
SADSENDPDVCGINGASAALAVSDIPFNGPIGAVRVGLIEGQNIVNPTYDEMRASKLNIM
VVGTAEGIVMIESGAHEATEEEVVSAIEFGHGEIKKICAVISKLAKEVGKTKRTVAPVEL
DQPYLDGLRKKIGADLADALNTEKYPKSESYAKVKEIKSKLKEEIPADDDAALKKLGKYY
ELLREDIFRQQVTKEKRRPDGRAFDQIRQIWIEVDVLPRTHGSAVFTRGETQALVTTTLG
TGDDMQRMEGFEGEAKKRFMLHYNFPPFSVGEVAFLRGAGRREIGHGALAERALSAVLPS
EDKWPYAMRVVSDILESNGSSSMASICGGSLSLMDAGVPLKAPVAGIAMGLVKEGDDYAI
LTDIAGAEDHYGDMDFKVAGTTQGITALQMDIKIGGITAQIMREALEQARRGRLFILDKM
NEVIQSPRTELSEFAPRFYTLQIPTDKIRDLIGPGGKVIRGIVEATGVKIDVEDSGKVNV
ASSDQEAAKKALKMIGDITATAEVGKTYLGTVTRLADFGAFVEILPGTDGLLHISEVAEH
RIKDVKDELHEGDQVLVKVLAVDGNRIKLSRKAVLKEQRAKMATEGGGDGGPAPEVEHSE
HGAPGGVTFEGGYEGGDEPEVEEGEPNFNRDDAPGSHGATQPHSGGDRPDRGPRPHGGGG
GAGRGGRGRRPGGGGGGGRGGHGGRGGGGGGRGRG
Download sequence
Identical sequences Q1IQ54
gi|94969022|ref|YP_591070.1| 204669.Acid345_1995 WP_011522797.1.86553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]