SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336123969|ref|YP_004566017.1| from Vibrio anguillarum 775

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336123969|ref|YP_004566017.1|
Domain Number 1 Region: 2455-2796
Classification Level Classification E-value
Superfamily Adenylylcyclase toxin (the edema factor) 2.75e-66
Family Adenylylcyclase toxin (the edema factor) 0.00025
Further Details:      
 
Domain Number 2 Region: 1885-2022
Classification Level Classification E-value
Superfamily PMT central region-like 2.88e-32
Family PMT central region-like 0.0069
Further Details:      
 
Domain Number 3 Region: 2036-2156
Classification Level Classification E-value
Superfamily PMT central region-like 1.83e-29
Family PMT central region-like 0.0016
Further Details:      
 
Domain Number 4 Region: 2202-2361
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.14e-19
Family ADP-ribosylating toxins 0.0087
Further Details:      
 
Domain Number 5 Region: 3879-4076
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000301
Family Serralysin-like metalloprotease, C-terminal domain 0.0056
Further Details:      
 
Weak hits

Sequence:  gi|336123969|ref|YP_004566017.1|
Domain Number - Region: 3790-3881
Classification Level Classification E-value
Superfamily beta-Roll 0.000116
Family Serralysin-like metalloprotease, C-terminal domain 0.0036
Further Details:      
 
Domain Number - Region: 1278-1418
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00156
Family CBM11 0.06
Further Details:      
 
Domain Number - Region: 3312-3373,3509-3571
Classification Level Classification E-value
Superfamily beta-Roll 0.00575
Family Serralysin-like metalloprotease, C-terminal domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336123969|ref|YP_004566017.1|
Sequence length 4157
Comment FrpC [Vibrio anguillarum 775]
Sequence
MRFVGAGVANSISSRVESGNLHFSGAGADNHLVRKGKVGDITLEGAGASNRIERTHNAND
VYTETRGNIRFEGVGGYNSLYSDVAHGDIHFSGGGAYNTITRKGSGGDFDAQGMEYAKAD
EIVLTTAQMHGLSIDNGNKFHAVNAVKSEREPNTYLFAIADGNYTKINKIRLYNDAESGK
LKYYSEAWFKQGNHLTDLAHSDVSFSGGFESNPVNGGYTLSNIAIEHQQSVTVHAVEKSL
TEYEWVTYANGVVIDAKDVSLSDAKMGGHAIFADGTKVDVKAVKSNRKPNTYVYAKMLGQ
HTKIVVVELANDAETGALKYQARSWYKEGDHTANLANQDISSAYGYHAMGKGGYSLSDLH
YSVNAIRSTSETVADIDEYTDQTLFKPVSDSGESSGDIHFNGVGGGNVIKSNVTRGHVYF
NGGGLANVILHSSQFGNTEFNGAGAANVIVKSGEEGDLTFRGAGLANVLVHQSQQGKMDV
YAGGALNVLVRVGNGDYLARLLAYGNISVQKGQGNSRVTLLGGYNTHTQIGSGDALWLAA
GGFNVMTQVGQGDVASVLAGGANVLTKMGDGELTAGMLGGANVITHISSDDQLSNTTAVA
LGGANILTKKGKGNTLAVMGGGANVLTHVGDGTTTGVMVGGANILTKVGNGDTTGIMLGV
GNVLTHVGDGQTLGVMGAAGNIFTKVGDGTSISVMIGAGNIFTHVGEGNAWALMGGLGNV
FTKVGNGDALALMVAEANVFTHIGDGMSVALMLAKGNIATKVGNGTTLAAMVGNANIFTH
VGSGSTFAAMIGQANIMTKVGDDLTAALMVGKANIYTHVGDGTSLGIFAGEVNVMTKVGN
GTTLAAMFGKANIMTHVGDGLTGVLALGEANIVTKVGDDFMGVVAAAKANVVTHVGDATT
AAVLAGKGNILTKVGEGTTVGLLISDIGNVMTHVGDGTTIGIAKGKANIITKVGDGLGVN
VAWGQANVFTHVGDGDRYNFAKGEANVISKVGDGQEVSVVQGQANIITHVGDGDDYTGAW
GKANVITKVGNGRNVVLAKGEANIVTQVGDGDSFNALWSKGNIVTKVGDGMQVTAAKGKA
NVTTRVGDGLNVTAAYGDANINTVVGDGISVNVAWGQYNVNTKIGDGLNVAVMKGKANAN
IHVGDGLGVNASYAQNNVAIKIGNGDFYSLAVASSNTSSNKLSALFDNIKQTVLGVGGSQ
AINYLVQGDEASSSGTHKGRGAIATPEITKLDGFQMEAIEEVGSDLGDSLTGSVTKVDAP
DLNQMQNALSVDDSSDQVQGPNLIVNGDFEQGEYGWRASNGIEAGFSANGYGVASEGHGN
RVSELDTYINTTIFQDLNDLNHGEVITLSFDFAKRAGISNNEGIDVLWNGEVVFSSSGDE
SAWQKKTLKLTAQAGSNRIEFKGTGHDDGLGYILDNVVAKLETLQQTNAVSEHATQNQAS
QNALSDKERAEADRQRLEQEKQKQLDAVAGSQSQLESTDQQALENNGQAQRDAVKEESEA
VTAELTELAQGLDVLDDRATHTGESGDQWRNNFAGGLLDGVQTQLDNAKQVSGEQIAAAK
QTHADNQNKVKDSVAQSEAGVAKGEQNLAGAEQGIADAKTDAEKRKADALAKGNDAKEAE
SDAHSAANDAQSRGDRDAMNAEHKANQVQNDAKGAKQNESDRPDRQGVAGSGLVGQAHSV
EAAGAAGRHINADSQTNADGRFSEGLSEQELEALEGATNAVNRLQINAGIRAKNTGSSVT
SMFTETNADSIVVPTTASQDVSCQEIHISRGDLEGLGEVSSHTVMDGNAIDNMLRDSLPF
YSLRAERNLLVQEGDEGLEVRAWPGTDDNSKIIVLDDPEDAAQQKAIERFILANFDNFEQ
MPDELFLVDNKVISHHEGRTRVLAQKEEGAWKYNTKAELMSVTELLDAASVTGKIRGESY
QQVIDALAEYNLSTFEHADYELESVEKLVNLCKQIEGYVLGHPDSGRVETMKSLLNQVNS
RLEAVSVLAVSDQSIKDHDSFSRLYDQLDNANLKNKQYLDTDSPQSAERALESLGEGKQT
TLDLSSVSTKDELKNEAKVFAKPIGESYQKILDQLDLLHTTQGDKQIEAALRLNNLVDDY
VSHHEKSGRNTALLSLKNRVSESLYNNVAEETRVEIAKLSATRIDLAADLLHRLHSSTNK
VSSVVDIKHLADGTKYSSQESLAVLSKQEVPFNKELQDQQLVQGRETGEAVVNNVQLSDD
EIKGIKWYTSEGFQYVNEALRKEDKLTYFVKDNAVNAVKGLNKLETFEGTVYRAFMPGVS
LNDLASQVTPGQLFSDQGFTSTSTSTELAKSFRGGKDTVILTILDAKGTNVAGLAQLNQA
EVLLKPGAHLRIEAVKETDQNLHIVAKYTEEFHAGETVRNLFDGKTIGIAINRNTSTINE
SVITSFDHDEITTLLKNKPVLDDAETISNADSHHKNYQSRDLVLEPIVQPETIELGMPDI
DQKILAEVAERENVIIGVRPVDEKSKSLIDSKLYSSKGLFVKAKSSDWGPMSGFIPVDQS
FAKASARRDLNKFNGYAEQSIESGNAVSADLYLNQVRMDELVSKYQSLTALEFDAESGMY
KTTATNGDQTVTFFLNKVTVESKDLWQVHYMKDGELAPFKVIGDPVSKQPMTADYDLLTV
MYSYADLGPQDKVKQPLTWEQWKESVTYEDLTPKYQELYDSEVLYNKKDGASLGVVSDRL
KTLKDVINTSLGRTDGLEMVHHGADDANPYAVMADNFPATFFVPKSFFMEDGLGEGKGSI
QTYFNVNEQGAVVIRDPQEFSNFQQVAINVSYRASLNDKWNAGLDDQLFTPKRKLSHEFL
VARDKIAKMLSNESSDLGNDSELEGIAERRTVGSVINHNEAREGEQGSKVVHTIDTLPSS
EILDQVIRDLNKSSTLMSETNFYDPKKFESDSVRVKVEWKQTLTNINNIRSMYFPHDMAR
YFEALKDYKVGNCGDRALYAAHFIMDKYNFQGEVELLKLKGSGDHVFVRVGGTSDSAKII
DPWTGQHFAHSQIKTFLYNPKEKKVEVHRSFDNLKALFKNLHLTSLNSLTKVQNHNVENW
ENVVVIPIADGGETRFDGQVIVQMENDSVVAKAAANLAGKHPENSVVVQLDSEGNYRVVY
GDPSKLDGKLRWQLVGHGRDDSEHNNTRLSGYSADELAVKLAKFQQAFGQAENISNKPDH
ISIVGCSLVSDDKQKGFGHQFINAMDANGLRVDVSVRNSDVAVDTTGRKHTQDANGNWVK
KAANNKVSLTWNTQGEVTVRDEIIRNGVAEGDIHLSRVGASEVNEPARGAIGDNSEVFEA
PEKRKTETDTTASAGSDNKLSYSGNIQVNVGDGEFTAVNWGTSNVGIKVGTGGFKSLAFG
DNNVMVHIGNGDSKHSVDIAGYQALEGAQMFMGNRNVSFNMGRSNGLIVMMDKSIPTPPL
VNPFDGASRISGVLQSIAQSGKGADWLTAQEQQWTLSGAKKFVKEMSGLDQTSSVDYTSL
VDLDSQNERSSRGLKSDAEATLNKKYNQWLSGNSNNDTGKMSRADKFRQMNEKLAFNFAV
GGQGADIQVTTGNWNFMFGDNIQAILDTNLGSLFGVLTQQFSATGMAQTTFTYNPQDLPR
QLKNKLLGKFAEVGAETTLGDIFGVNYTADGKIVSRTDEAVDGVAILKEMLEVIGEFGGE
QLSAFTDPEKLLDSLKAGIDMGADGLQSFAESHGLKEKAPEENDTAQVTLNGAPAATENV
SATVEETKPERAFGFNALNFPNLFATMFSKDKQTEMASLVSNLKQNLTADLLNMKDKTFD
FLRNSGHLQGDGDMNVSLGNYNFNWGGDGKDLGAYLGDNNNFWGGRGDDVFYATGVSNIF
TGGEGHDMGVLMGRENMMFGGDGNDTAVVAGRINHVFMGAGDDQSFVFGEGGEITMGSGN
DYAVTSGNFNRVDMGDDQDFAVTIGNNNQLDLGAGNDFARVFGNHNRIDAGQGNDEVKLM
GYHASINAGEGEDYLIAAAISKFSTLNGGEGNDVMVLGGYQNTFKGGAGVDSFVVSGEVI
DNVVEDIRQGENIIFNGIDWNRLWFERSGYDLKISMARHTDTSSDQTLFDALGCVTFNDY
FANNRAKLIIGLGEKDAQGEQEYTCLTDNALDNLIQAMSSFAPKVGESNFMDGLASQPQQ
AIMAAWSDVNTGKFSLS
Download sequence
Identical sequences F7YQG4
gi|336123969|ref|YP_004566017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]