SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for fge1_pm_C_17000080.1 from Aspergillus niger ATCC 1015

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  fge1_pm_C_17000080.1
Domain Number 1 Region: 142-227
Classification Level Classification E-value
Superfamily HMG-box 7.46e-27
Family HMG-box 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) fge1_pm_C_17000080.1
Sequence length 695
Comment | fge1_pm_C_17000080 | Aspergillus niger fge1_pm_C_17000080 (696 aa)
Sequence
MSYDRVLPKPPLLHHDSSHHLPLSRPTSNLLEHKIMNDDVAKVSMMDRHLDTAALSGHRR
FTDTLPPVHLTSLNRSKVALNKVASNAASAIETPKPTNFLATKAIPLRERSSLSERSSSS
SPIKSSNAPTPRESATQFCLCQPDPKIPRPRNAFILYRQHYQAAVVAQNPGLANPEISKI
IGEQWRGLPQETKDEWKALAEEEKARHQQQYPEYRYQPRRYGRDGNLRSGASGISHNPPG
STVCSRCGGRVMNPPVSPETPYTPRASFFGGKSAPGEVFSARSNQCRAKDLDRAPNVIKL
IPNGNGESRLPRQHFVESRSRSPDNKRRRLGPLGPYDIRERSPDSSYPASPYTPRSAVAD
SRGLYQPLQQPRPGRNFKEYTPPDPSLKLPPLQTATHVPGTITPTTPYSHDGPSIEATVM
TIPFLNKIKVLAKISPPLTPAYHDGSSFRRGAVIAVDGQDPVLVKIMVEFLNNTLQKEGR
YHTQIFGGPEIRSRESYSESEQMGDATVDYLNIISSWHRISDEIVSFVKPSRASSESKSV
DEESTPGVSPRTIIPKTADLQINSPEQLSDNSSVSTVSTGLGSITMPVPVALVPRYQLTT
ADAFACSVPIGDSYAPLDHWQWMASLWRACVGPDITVYIRECEKDELERLGGSPVEVRLH
DARTIVVRRLASSPSELEEKSLKRVGFEIEDFLTQ
Download sequence
Identical sequences A0A254U080 A2QJ51 G3Y9F9
CADANGAP00004202 5061.CADANGAP00004202 fge1_pm_C_17000080.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]