SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for fge1_pm_C_7000191.1 from Aspergillus niger ATCC 1015

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  fge1_pm_C_7000191.1
Domain Number 1 Region: 143-227
Classification Level Classification E-value
Superfamily HMG-box 4.19e-25
Family HMG-box 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) fge1_pm_C_7000191.1
Sequence length 675
Comment | fge1_pm_C_7000191 | Aspergillus niger fge1_pm_C_7000191 (676 aa)
Sequence
MSCDRILPKPPLLNHDSSHHPFLPWPTGNLLEKKFSSIGVDKVSIMDRELKTDALGGHHR
STDTLPHVHQYSLNRSKITHNKVSSNTTSTIEAPESTNHSSTNSIPLRESSSLSKIPSSS
SPVKSSNTPDPSESATHFCLCHPDPKIPRPRNAFILYRQHYQAAVAAQNPGLASFEISKI
IGEQWRGLPQETKDEWKALAEEEKARHRQQYPEYRFQPRRYNRDGNLRSGASGISHNPPG
STLCNRCGGRLLNPPVSPEIPYTARASLLGAKPASGEDFAARSSHRSRQSRLLRQQFAQS
RSRSPDSKRRRVRLPRPYDVRERSPHSSFPTSPYTPRSAAADSRSLCQPLQHSSPGRNVK
EYTPPDPSLKLTRLQTAAHVSRTNTPTTPYSHGTSIEATVMTIPFLDKIKMLAKISPPLT
PAYHDGYSVRRGVVIAVDGQDPVLVKTLIGFLNNTLRKDGRYHTRVFDGPEIQSRESYSD
SEQKADAIAGYLNIIISWHRISSEIVSFVKPSWASSEPRSVEEESTSGVSPRTIIPKPAE
LQINSLEQSSNNNSMSTGPSGPGLITVSVPVALIPQYQLTTTDAFACSVQSRDSYAPLDH
WEWMASLWRALVGPDVTVYIRECRKEELERHGANPVEIRLHDARTIVVRVAASSNQLMEK
SLRRVAFEIEDFLTQ
Download sequence
Identical sequences G3Y5E8
fge1_pm_C_7000191.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]