SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Auran1|28862 from Aureococcus anophagefferens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Auran1|28862
Domain Number 1 Region: 283-655
Classification Level Classification E-value
Superfamily SIS domain 1.02e-71
Family double-SIS domain 0.000005
Further Details:      
 
Domain Number 2 Region: 29-262
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.24e-54
Family Class II glutamine amidotransferases 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Auran1|28862
Sequence length 656
Sequence
MWRAAALRAGGATLVGSSLFGDGEAARACGIVGVVGHSPDAKDILLDGLAILQNRGYDSA
GMATMRRADGGGACDVAVTKYASRGSTADSVALVRAEAEKHAAHTIGIAHTRWATHGGKT
DENAHPHFDCRDRVGVVHNGVIMNADVLRDELEARGVVFRSQTDTEVIAQLIGERLEEEA
GLSLVDATQKALARCEGTWGVCALERSDASSVVVACNGSPMNIGLAKDRTFIASETSAFN
RHTKNFIAMQDGEIGVVRAGETTLDIRRAEVAPDLELRKSPAPYKHWMEREIREQPEAIA
RALAFGGRLGEDKVFLGGLDRQRDRMRDIEHVLLVGCGTSLNASAYGARLMRDLGAFDTA
QAMDASEVGVHDIPPKSSGVIAVSQSGETKDVLRTVKKAMDADVAALSIVNTVGSLIART
TKLGVYLNAGRENAVASTKAFTTQVTVLALITCWFHQLRAADAAADGKKAHYSEKFKELM
VALQRLPISFGMGLRLQDQCRVVAERLKTADHLFILGKGYGEPIASEGALKIKECTYVHA
EGFAGGALKHGPFALISEDMTKRTPIIMLILDDEHAAMMRTAAEEVKARHADVIVITDDA
ALAHGVDADPIVIPRNGKLTALGAVLPLQFIAYELALLRGVNPDFPRHLAKSVTVD
Download sequence
Identical sequences F0YDW2
XP_009038596.1.21850 jgi|Auran1|28862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]