SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Auran1|52281 from Aureococcus anophagefferens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Auran1|52281
Domain Number 1 Region: 30-328
Classification Level Classification E-value
Superfamily SIS domain 9.79e-63
Family Phosphoglucose isomerase, PGI 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Auran1|52281
Sequence length 357
Sequence
MGLGLFEDARAGAASGFGSFGDRDGPGAVTETDEWRKLSRHARKVEKTHLRRLLESEQRV
AEMSLDAADVGVFLDWTRQKVDDKTMRLLFKLARRMDVPRKVEQMRRGERINSSERRAVL
HTALRAPRGAASQTAPADSALVPVDEAIAASCDVRDRLFAFVDDVRRGAATSAAAEPFES
VVAVGIGGSYLGPEFIVQATAGVKAMESDGRDLEVRFVANVDPVAFTAAKKGLDPRKTLV
IVVSKSWSTAETLRNAAKVKAWVLDAFPDEDEAAVVKAHFVACASRTAHDRVASWGVDAD
ARLFEFWNWVGGRYSASSSAGLLPLALARGTRWTSTSTRSRSRRTRPRSWRSWASGT
Download sequence
Identical sequences F0XXK8
jgi|Auran1|52281 XP_009033069.1.21850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]