SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Auran1|63462 from Aureococcus anophagefferens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Auran1|63462
Domain Number 1 Region: 1300-1422
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000456
Family Regulator of G-protein signaling, RGS 0.0018
Further Details:      
 
Domain Number 2 Region: 346-477
Classification Level Classification E-value
Superfamily SIS domain 0.00000156
Family mono-SIS domain 0.027
Further Details:      
 
Domain Number 3 Region: 1162-1270
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000249
Family cAMP-binding domain 0.0075
Further Details:      
 
Weak hits

Sequence:  jgi|Auran1|63462
Domain Number - Region: 120-185
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.00212
Family Class II glutamine amidotransferases 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Auran1|63462
Sequence length 1443
Sequence
MALDALRAWLAVRLGRAPPSTGDSCVASGALELLFAAGDCAAAARLALAPLDDARAGDVA
LRSAVAAALRRVLDELRDPARAFASSDAKARDAVEARLQKLLSTTSLDARERAAVAEAAL
RGYSEWDLRSAVWRFLKTAHGAFGLCATTSLAPGAVVLGSVKQPLIVGVGRGFVAYASER
AAVHVGAIGAALKYRYVLAEGDVVSVAPEATVQGTLGGSGCRLALARVDADAAVFRDLGS
TDLCDAERNALMMRPLPGGPPGDVVGDDLRDLPVLASALARSFRLDTSPNAAAARAFAKA
VFDADRMRRSSLDVVVVAVEASLWVAEQWAANARAACPVLRVVVASANKALAALTACESG
THGGATSAHATVFPSGDTPARRCRGAVALAVSHSGQTFPTLNAARALRDAGADVFVVAGS
LDVQLAEVVKGGQSFRKGARRSKRVLVTGAGVRLAEAASLTTALTHVLLTELLLALAAKA
PRGSCLLRAGDVKDLETLADACVHDHLPNLCPGPAPRPSRDAHAGARALGERWADHVLEP
LACFVLATAYVLVSVTAGTPLVTTAVFYSCGYRSPAVAALDALLYAFFPVVAALVLRFVQ
KRTMLARFGRRTIMVLDVPMVHQCAVAFGQKLFGLSYGLNGVDFAGANPRGHRTAGANPA
DHGVHRMLHRVVRGTLVALGVPDGRLKALVDVECAAYLTALQLKSLSNWGVGAELATVGH
HSYVPGVVDAALIFDAFQRPVFLSEVHHASPRAPDARRLSFLEAPEARFGAVGPGVVGAA
RAAGDEDPRALLAAHAVVETLYEGRVASLERLVAFYAAFHALAAKTSRASGWLCLLSFDI
WRSQAGTRVATTPAPASPAAPVDGGRPRDDLERVATTDQFLASLDASQRGSGGWLNRALD
ASQRGSGGWLNRPARSRTASDEKGLDDSRRSWRDLAAGVAAALGVRENRSVSASLDVSAY
AALDMDLSRGGTPWGDHAHFAAATALAVPTAAPSAPSSRASSPGPGLDLDKSLSGDAPLS
LGLDLQRAAPPAAPLPVRALRDAFPPILGVRPRASQPTDLARLDEVNSEKTKSRDSLEDL
DVVLQDSFRQDPPPDDDTAADAADAAAPGDGADAPPPAPEPRTPRPGAMARATVALTPQI
QKRMDVLSKVFEGWEEDCMNCKAFAASLADWTTPKGAEVIREGEDAAQPQLLICESGAAE
VFVTTTTKSGAKKQKRVARLVAPFYVGEGQVIARSVPTATIKAAQDLAGFSLDLESCDEL
LRTDSLAIRLVKRQIEIRAFERAPARAHTYNDGLFFGNIDNAAFFAAFEAFAKRTFCAEN
VVFLRGYRDLQTETDAAAAVARVERLFRDHVDVDASDADNLAVNVSQKVVRESKKNFAAA
READDVAALRTVFDKCAEEINQMLTKDIIPNFMNGDEYRAYLLGAWPLPKRPPKRRSTAC
GLM
Download sequence
Identical sequences F0Y757
XP_009036069.1.21850 jgi|Auran1|63462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]