SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Auran1|69676 from Aureococcus anophagefferens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Auran1|69676
Domain Number 1 Region: 28-557
Classification Level Classification E-value
Superfamily SIS domain 6.16e-166
Family Phosphoglucose isomerase, PGI 0.00000000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Auran1|69676
Sequence length 559
Sequence
MASMEETIKSMLCGTTSGGSSSLISASSEWKAVAACAAKLKATHLRDALENADRNANLLT
EAEGIVLDYAREKVDGDAMAALFALARKANVEAKRDAMFNGDVINETEQRSVYHVALRAP
KGSSPMLANGEDQVAKVNGVLDRIEDFSDRVRSGAWKGATGEALTTVLAIGIGGSYLGPE
FLCEALRAEPAAAAAAAGRDLKFVANVDPVDFARQVAGLDASKTLVVIVSKSFTTAETIM
NAKTVKNWLLANVKGDADAVVRQHVAAVSTQLDLTAQFGIAPENVFEFGDYVGGRFSVHS
PVGMLPLALQYGMAPMRSFLAGARNMDEHFASAPLESNLPVILGLLGLYNSSFLGYECKA
ILPYAQALLRFAAHVQQLDMESNGKSVAMDGSKLDFAAGEVIFGEPGTNGQHSFYQLMHQ
GRVVPAEFIGFAKSQAPVHLDGAPLSNHDELMCNFFAQPDALACGSHNDDPHKHFDGDRP
SLSLLFGEVSAYTMGQLLALYEHRVAVQGFVWGINSFDQWGVQLGKVLAKQVAAALKDAK
TDGFNSSTSALLAKYIAAK
Download sequence
Identical sequences F0XZV1
jgi|Auran1|69676 XP_009033908.1.21850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]