SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Auran1|69855 from Aureococcus anophagefferens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Auran1|69855
Domain Number 1 Region: 31-516
Classification Level Classification E-value
Superfamily SIS domain 1e-135
Family Phosphoglucose isomerase, PGI 0.0000000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Auran1|69855
Sequence length 527
Sequence
MSLRLLLVAVAHARLAPIRQRAASLRGGADAAWDALRAHVAADIESTHLRDLLRDDARNA
ALTFACGDITLDCSRQRATVETLRLLAALGEARGVAAKRDAMLRGDLVNESEGRAALHTA
LRAPRGAAPVLVDGADVHAAIHDTLDRAYAFAGKVRAGGVGSTGKMLTNVVAIGIGGSCL
GPECVYEALRSEPAAQAAAAGRSLRFISNVNPAMAVAGHFCAVSSDVEKAANFGVEPDNV
FGFGDYVGGRFSVHSPVGALPLALHFGPSIFRKFLEGARACDDHFASAPLEENLPVLLGL
FGAYNSAVLGFPCRAVLPYAQALSRFPAHVQQLDMESNGKSVASDGSALAGDAGEIIFGE
PGTNGQHSFYQLMHQGRAVPAEFIGFCESQRPAHAKGRPLSCHDELMANFFAQPDALAMG
DVDEAHPERACPGNRPSLSLLLPRLDAYHVGFLVALYEHRVAVQSFLFGNNAFDQWGVQL
GKVLAGRVADALGDAAEAAALNSSTRGLVAAYRRHARASIEAVASGS
Download sequence
Identical sequences F0YD40
jgi|Auran1|69855 XP_009038231.1.21850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]