SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Auran1|72644 from Aureococcus anophagefferens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Auran1|72644
Domain Number 1 Region: 857-899
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000628
Family Kelch motif 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Auran1|72644
Sequence length 988
Sequence
MRQVMCAILALAFGATALERVAGGGDVVYKGIPGTGAGDVNARVFKGVPGTGADADADAW
AGVAEDASSLLKMEDTLRRQLENKRDWVFSYDFADAEPTAKPTSSPTFTPCDVEGEYRYY
LALYDYGGDGWEGATYTLYKYVGVRQGEQILTGTVETGSEEVINFCLPNGLYAVDFGGGS
DDGEIGIQFLPDDLQMITTCTGPCVERFLAVDGIVMPPTEPPTASNFGQPTAFDASQTAW
MYLSFLVDGLNGEALISEAGFSAFAYAINDVIPFLTGPEAVADLTATFGEARRRQLLQAA
GDDTASIEAVILMDTCAMAGHNSNDDCLDAMVEDVAIAIADGVMLERILYWADYFGLDLG
DDFTVVSIVSDPEPYWVYAPTAAPSAKPTAAPTTTTTTAAPTPVTTTAAPPVTDAPDSGS
SSKKKSSDDGLDSGAMAGIIVAIVVVLLLVMGGVYFKQRERKATERKDSWDISTMFTDEQ
NLPPADQMVAETPAGDQPQALQKITQAAELPESDLRGAAAPRAAGQMPLQYDLTVGDLVV
AATAWKGVMVGDRGVVVEPGEDLPYKRCRIKFDDGKGTYVYTKGQQARRVPILGGYVLGD
GVLANAARPGQINVGDRGVVVGRGRSLQDALLVRFPNGVDAEISAGRARPASVVVVPGAP
PIFKGDVVLALVDYETVTVGDRGVVVGPCCDPAMSRPDLRVLVDFENKAAYNFRSDAHLR
LAPLVEGTNFVRGDKVILPGLDKKVIGVVIGVGRCAGTLAVKGYGALPRDVALARLKHAP
LVAGAPHFAKGTRVVAKVAYNEVRVGDRGVVVGPCMQPEMQNAAKRVLVDFGRKGVYNYH
VDTQLTCVHGDEDAPEATAYDADSDTWTKIENMPGGERYGMASVVHDGKLFVFGGRASGP
VFCAIDDGKPMPPAMLLYEPGAEPLPPADEPAAEPPPPPPKQLTGAAALLETLDKFKAAN
GGVDDRYYAAMRSALEELEIEEREEQGS
Download sequence
Identical sequences F0YLQ1
jgi|Auran1|72644 XP_009041365.1.21850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]