SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ACLA_048460 from Aspergillus clavatus NRRL 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ACLA_048460
Domain Number 1 Region: 127-311
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.97e-37
Family Hypothetical protein AT3g04780/F7O18 27 0.00029
Further Details:      
 
Domain Number 2 Region: 3-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.87e-31
Family Thioltransferase 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ACLA_048460
Sequence length 330
Comment | Aspergillus clavatus null (331 aa)
Sequence
MSAPIHISSKEQFSSLLTTSKFVVADFYADWCGPCKQIAPAYEQLASQLSRPNRITFTKV
NVDQQQEIARAYGVTAMPTFIVFQQGRPISTVRGADPKALSDAVRKLASEASKEDSGDAS
GDLSGGNGWIGAAAPKGYSDITDQHEPKGVELLNRDSDFGTAKTLFESSKPSALSERGKA
KEGAPVDWVESDTDEQLMLFVPFQSTLKVHSLQITSCVSASEDDEDAPMRPKTVQLYTNR
SHVLGFDEADGIPPVQTVTIQPEDWDAKTATAKVDLRFVKFQNVTSLVVFFVDGDGDSEK
LRVDRIRIFGEAGEKREMGKLEKIGDEPGE
Download sequence
Identical sequences A1CHM1
XP_001271802.1.35617 5057.CADACLAP00004438 ACLA_048460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]