SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AO090003001039 from Aspergillus oryzae RIB40

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AO090003001039
Domain Number 1 Region: 208-282
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.85e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AO090003001039
Sequence length 305
Comment | Aspergillus oryzae Unknown (306 aa)
Sequence
MIAEGAANDAGAVLGAESMSSGNAVFPPPDDPEPRDRQPFGVLTPNPPLPEGHPGANGQR
FFTIQRVNGNGANGKNDGVSGGHRHTLEESDRVKKNSVQRYLLKEAREKKKASSQSIIPA
SLFPFPRFLTSCCMVSFSMFLRSLFQTQRQRLLSYLEFPAICLPPAVYSRSLIQPAQKVR
AMSTQNQPSQKTYHTKATGLAALTVSNHSSENELKLYGSCFCPFVQRVWIALEAKGIPYQ
YIEVDPYKKPQSLLEVNPRGLVPALRHGDWGSHESTVLLEYVSNPTTLKRVKPDETLTLS
CSLKT
Download sequence
Identical sequences Q2UJX0
5062.CADAORAP00001579 AO090003001039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]