SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AO090011000514 from Aspergillus oryzae RIB40

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AO090011000514
Domain Number 1 Region: 72-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-20
Family Cold shock DNA-binding domain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 165-269
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000209
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AO090011000514
Sequence length 272
Comment | Aspergillus oryzae Unknown (273 aa)
Sequence
MASPLILLPGDEVPSEYLPSNNSAPLRLGAGLRLLSQPSSNPPSHVITATQPGLLSTDNK
RNAVSILSTPNRRYLPTPGDLVIAQIHHSSPDYFHCMITPQAPQALLGQLSFEGATKKTR
PMLKQGDLVYARVLSTGLGAGAEVELTCVNPATGRADGGLGPLTGGMVFDVSTGLAARLI
KASSSSAEQQDGVAGLVVLDELGKKLEKAGGFEIAVGRNGKVWVDCANGGDYAVKATVAI
GRCLSTIDEHELSSTDQRKLVTRILREMKIES
Download sequence
Identical sequences A0A0D9N210 A0A1S9DCZ8 B8NAW5 I8TJQ4 Q2U0A8
5059.CADAFLAP00005667 5062.CADAORAP00005165 AFL2T_05275 XP_001826140.1.101437 XP_002377802.1.25037 AO090011000514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]