SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AO090012000676 from Aspergillus oryzae RIB40

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AO090012000676
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.32e-28
Family Glutathione peroxidase-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AO090012000676
Sequence length 166
Comment | Aspergillus oryzae Unknown (167 aa)
Sequence
MALKPGDSFPENVVFQYVPWTEEKGDITACGIPIPYNASKEWADKKVVLFSVPGAFTPTC
SVNHVPGYIQNLPQLKEKGVQVVAVVASNDPFVMSAWGKANKVENNDILFLSDPDAKFSD
SIGWANNGRTGRYAIVIDHGKVTYAQIETERGVVKVSGAEAVLAHL
Download sequence
Identical sequences A0A0D9MXZ2 A0A1S9DQM0 I8A2Z6 Q2UCA3
AFL2T_03552 5062.CADAORAP00006102 XP_001727651.1.101437 AO090012000676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]