SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AO090020000180 from Aspergillus oryzae RIB40

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AO090020000180
Domain Number 1 Region: 129-294
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.03e-52
Family Glutathione peroxidase-like 0.0000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AO090020000180
Sequence length 322
Comment | Aspergillus oryzae Unknown (323 aa)
Sequence
MASTMRPLVQMVGRASRSTVPSLERSTLRSIPSQNAFLPLRTKPAQPAYTQTLRHNGLSS
QRSFSTTTLRARARTMGQLKARNSTGPFSWKSALLFVITGAGMIVYFRVEKERLARKRIA
EMSKGVGRPKVGGPFVLKDLDGKQFTDEDLKGKYSFVYFGFTHCPDICPDELDKMAEIID
KVKEATKGENIFLPVFVTCDPARDTPEVLRSYLQEFHGDIIGLTGTYEQVKNMCKQYRVY
FSTPQNVNPGEDYLVDHSIYFYLMDPEGDFVECIGRQDTPDSATKVIMEHINDWKREELI
STWSHIPISLSSQLTIYSTQPV
Download sequence
Identical sequences I8TUP9 Q2U4W1
AO090020000180 5062.CADAORAP00006561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]