SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AO090023000702 from Aspergillus oryzae RIB40

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AO090023000702
Domain Number 1 Region: 8-219
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-68
Family Glutathione peroxidase-like 0.00000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AO090023000702
Sequence length 225
Comment | Aspergillus oryzae Unknown (226 aa)
Sequence
MAQERAAPIRLGSTAPNFDADTSNGPISFHDYIGNSWAILFSHPDDFTPICTTELGAFAK
LEPEFTARGVKLIGLSANGTDSHKLWIKDIDEVTGSKLTFPIIADPERKVAYAYDMVDYQ
DTTNVDSKGLALTIRSVFIIDPNKKIRLIMSYPASTGRNTAEVLRVVDALQTTDKHGVTT
PINWLPGDDVVIPPPVSTEDAQKKFGEIRAVKPYLRFTNLNNKKE
Download sequence
Identical sequences A0A1S9DYW6 I7ZTJ5 Q2UGV0
5062.CADAORAP00007641 AFL2T_04522 AO090023000702 XP_001821217.1.101437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]