SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AO090120000112 from Aspergillus oryzae RIB40

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AO090120000112
Domain Number 1 Region: 29-168
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.5e-29
Family Glutathione peroxidase-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AO090120000112
Sequence length 168
Comment | Aspergillus oryzae Unknown (169 aa)
Sequence
MSGIKAGDSFPSDVVFSYIPYTEEADKFNVCGIPINYNASKEWADKKVILFALPGAFTPV
CSANHVPEYKEKLPEIREKGVDVVAVLAYNDAYVMSAWAKANGVKNDDILFLSDPDAKFS
KSLGWADEEGRTKRYAIVIDHGKVTYAALEPAKNHLEFSRAETVIKHL
Download sequence
Identical sequences A0A0F0IMD1 A0A1S9D9B0 A0A2G7FGW0 B8NLH9 I8AAV7 Q2U6S7
XP_001823871.1.101437 XP_002380926.1.25037 AO090120000112 AFL2T_08144 5059.CADAFLAP00008791 5062.CADAORAP00011053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]