SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AO090120000338 from Aspergillus oryzae RIB40

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AO090120000338
Domain Number 1 Region: 71-199
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000514
Family Phosducin 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AO090120000338
Sequence length 210
Comment | Aspergillus oryzae Unknown (211 aa)
Sequence
MSSAQDEFNLLVQSNREKYSTHPEDRDNDSGHDSNPSEDEQDHPQFSDSEDHDPTMRTGS
STYRVPNIVFDANTGPKGVIADAQAFERARASSFRKTLHHNDHAKYVADDSHLLHHTPPP
DGSLSDEDEEHFLRQWREERIQELRNRSFRRPSPRRRMYGAPALLAYRGGDVFETIVEIV
RQIPKGRDCTSHTLEDLLKLYADCPRYRVL
Download sequence
Identical sequences I8AA65 Q2U687
AO090120000338 5062.CADAORAP00011243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]