SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|283781141|ref|YP_003371896.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283781141|ref|YP_003371896.1|
Domain Number 1 Region: 127-173
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000903
Family Tudor domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283781141|ref|YP_003371896.1|
Sequence length 210
Comment hypothetical protein Psta_3372 [Pirellula staleyi DSM 6068]
Sequence
MRGLRFSMSGGLSALTLLSVLLALMVSKSEIAGSVALTVYISVVCLATAGAIATLGNDKL
FWLGAAIFGWTYLFTEYEAVSSFEQMVQSPGVIMVPSGTSNLRPVSKMITSSLVELIEQN
VIGSRYVGATVMARWRNGSYYSGTIAEIEGSNYLVKWTDGSAPQWTPGTQILSNSPGTRS
SAHAILGTLFGLFGGMLVTLVFQKRETPAS
Download sequence
Identical sequences D2QXV9
gi|283781141|ref|YP_003371896.1| WP_012912298.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]