SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|283782210|ref|YP_003372965.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283782210|ref|YP_003372965.1|
Domain Number 1 Region: 975-1034,1069-1189,1333-1464
Classification Level Classification E-value
Superfamily Subtilisin-like 4.06e-49
Family Subtilases 0.0011
Further Details:      
 
Domain Number 2 Region: 484-730
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.77e-31
Family DNA/RNA non-specific endonuclease 0.0016
Further Details:      
 
Domain Number 3 Region: 118-340
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.35e-20
Family Prokaryotic proteases 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283782210|ref|YP_003372965.1|
Sequence length 1466
Comment DNA/RNA non-specific endonuclease [Pirellula staleyi DSM 6068]
Sequence
MPRDASLQALRRKLSKVAGTGNLESLAKERASAPTRDGTRESLASGSSGREDLVLRSFDL
ETVALRKLQNGDFDDVSPRERMHLEAIVEEDGRPVVFVIDDQFDTLPEPWTQFNAAPVRS
RINALIPSIGRIEDISGGIPQHIGTGFIVGPNLMMTNRHVAEAFVRGVGRFRDQLSFVPG
IESAIDFRRESGLDPSDLSTSLHLTDVVMVHPYWDMAIFRVEGLSAAHKALQLSVRAPED
LVGRNIVAIGYPGRGNDRSRRAVQLERKVFGTTFGVKRLAPGEIEVRERVESFDYVVPAM
THDSSTLAGNSGSAIIDVETGEVVGLHFAGITLKANYSVPLFELARDPRVVDSGINFVGS
VPPTDEWDRAWRGVESLGGGAVSAPIPSTPFVSGTGSSQTGTWTIPIQVSISIGQPLSIA
TVAPATAPVHAAREATFQVPVIHPNLEQRTGYDPNFLELDGGELVPMPELTSDGRDITSV
LADGSHELKYHKFSVVMHKQRRLALFSAANVSWQSADKMLSNGHKPTRKELNGFDNDYTI
ESWATDDRIPLEEQLHDKFLINDQGAFDRGHLVRRDDVAWGDSFLDMQKGNGDTFHTTNC
SPQVAKFNQASKGVDNWGDLENLIEDETTAERVIVFAGPVLDPSDKRFNGVDSSGPLKIQ
IPRQFWKIVIAKTEDGPKAFGFVLKQKLTGVPLEFAVPEDWEPYQVSIQEIEDLLFGLAT
LDWCKSHDAFANEGSRVVAIREHLSGLGGLTSTQGTLRDVVLNPQPIPHESEPVPGNPPV
QVSFPSTVAPETPLEASAGSTATWTIPLTVSVTIGSPLQNDLKTCSSELVPLNRNLPKPT
EAKSKPARTVVSPELTTVKHDTYLDHIGAFESKAALRRQENMIQVQESCLTTTLKSAEPE
RGSPTVNDPVFPMLVKVRSIEDWTCPIGFIERSVIGTIITGSGTAASLSSLNQDQNVLSI
EASRPAGILEWSSSSYVGAPAVHSSPAGETGCHCICGIIDTGIDILHKAFLTSDGTGESR
VLEIWDQRAEYGRTPAQEFPNLASLNYGTVFSMERIRSFVREGRVPAKLGRDDLGHGTHV
SSIAAGKAEGDYLGGVAPDAKIVLVIPKLSVMSSDPYSLGYSASHVEALAYLKSRAASFG
LPLVVNVSLGMNAGAHDGSSLLEAAFDAYTNGGTAPGLAIVKSAGNERAAGGHALIQIAN
GRTDLLEWLSDPEIHRPEDYLELWFNSSDICEFVLFSPTGQESRIVSRYSPRQVLTCEDG
TKSIIDLSYRHHDNGDSRLQITVRPNRYGRIAGGEWKLKVRGIDVKSEGWIHAWFERSGV
RPTRFLNNISQSYTLSIPGTARSVITVGGIDENGQNEPSSSFGPLRLDDAANPKPDLVAP
GASIEAAKAGTFSKCISMSGTSTAAPHVTGAIALVFSFHRKNGTSMPNAIQVKKALWQTT
KHYNGRHNNSFGYGILDIERFFEAMK
Download sequence
Identical sequences D2R620
WP_012913364.1.69553 gi|283782210|ref|YP_003372965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]