SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|283781884|ref|YP_003372639.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283781884|ref|YP_003372639.1|
Domain Number 1 Region: 144-200
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000314
Family Collagen-binding domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|283781884|ref|YP_003372639.1|
Domain Number - Region: 67-153
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0719
Family PspA lactotransferrin-binding region 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283781884|ref|YP_003372639.1|
Sequence length 264
Comment peptidase domain-containing protein [Pirellula staleyi DSM 6068]
Sequence
MLSIASRASRSLAAVAAAPLLAAIFSATLPAQEPQSAPVVLFVRPLVVTPGEMVTLDIRG
QHLQNTKQVQLRSGDFSQDLPVKKQEEAKPPDRVAPNLHGDYRVEAELKLPDDFAADQFE
LTIECDKGKTAPLSVRVLKTDQLLKEVEPNDGFRQSQAMELGKFIVASIHRQHDVDVFRI
ELKAGQKYKVDVEAAARGSVADLQLQLFSENGALLATSDDRSATSRDPELTFSPTSDGPI
LISLIDATDRGSDLHPYLLRVTPQ
Download sequence
Identical sequences D2R346
gi|283781884|ref|YP_003372639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]