SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|268680486|ref|YP_003304917.1| from Sulfurospirillum deleyianum DSM 6946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|268680486|ref|YP_003304917.1|
Domain Number 1 Region: 18-101
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.81e-20
Family Ferredoxin domains from multidomain proteins 0.017
Further Details:      
 
Weak hits

Sequence:  gi|268680486|ref|YP_003304917.1|
Domain Number - Region: 41-56,118-168
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00209
Family Di-heme elbow motif 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|268680486|ref|YP_003304917.1|
Sequence length 179
Comment 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Sulfurospirillum deleyianum DSM 6946]
Sequence
MMKLLDISKKYGEITHKYPFEPYKVAQNFRGKPAYTFDLCIGCAACGIACPSNAITVQFN
EDKSKLVWEFDCGRCIFCGRCDEVCPTGAIRLSEEFELAVKFDKSALIQRGELDVQCCTT
CHKPFSAKRLIKYSFECLSKANVSEKRLEEAKAYLSMCPTCKKEATVKNFTSGKEMVIE
Download sequence
Identical sequences D1B462
WP_012857630.1.51747 525898.Sdel_1867 gi|268680486|ref|YP_003304917.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]