SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|268316219|ref|YP_003289938.1| from Rhodothermus marinus DSM 4252

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|268316219|ref|YP_003289938.1|
Domain Number 1 Region: 139-564
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 3.79e-108
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000000227
Further Details:      
 
Domain Number 2 Region: 6-132
Classification Level Classification E-value
Superfamily Cytochrome c 2.82e-20
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|268316219|ref|YP_003289938.1|
Sequence length 565
Comment nitrite reductase [Rhodothermus marinus DSM 4252]
Sequence
MKGYRLIGLALGLLLGTWGLVIGCRQPESASDGQGVPAEEISLTEEEFARAKQLFFNYCA
GCHGTTRRGATGPHLLPEAPEGSTYPGTRQLGTAAIKAFITNGTPGGMPDWGRQGILSEE
EIDLLARFLQLPPPPIPPMNLEDMRASWKVHVPVEQRPTRPQHNRNWRNFVGVVLRDAGK
VAIIDGDTKELVSIINTGFAVHILRSSASGRYFYSVGRDGKVTLIDLWMDPPQMVAEIKS
AYDARSVDVSKYKGPKGDFIDRYAILGGYNPPHFVILDGLTLEPLKIIRTSGYDVNEGAF
YDEARVASIVASHHDPLWVVNVKETGQIWLVDYSGVAQGKVSIDVLKAEQFLHDGGWDHT
KRYFLVAANNKNKVVVVDVQEKEVEAIVETGRRPHPGRGANFYNPTYGHLWATGHLGDNT
IALIATDPGPNQWKVVKKLELPGVGGGTLFIKTHPKSRHLWVDRTLNNDPELQRTIYVFD
TETLELVKELKIPESIPNARAVHLEFNQNGDEVWVSAWGRKDDPSTNAILIYDDRTLELK
QVIQGDWLITPTGKFNVYNTANDIY
Download sequence
Identical sequences D0MFM3
WP_012843162.1.83145 518766.Rmar_0652 gi|268316219|ref|YP_003289938.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]