SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262194173|ref|YP_003265382.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262194173|ref|YP_003265382.1|
Domain Number 1 Region: 127-373
Classification Level Classification E-value
Superfamily Subtilisin-like 8.9e-66
Family Subtilases 0.0000243
Further Details:      
 
Domain Number 2 Region: 44-114
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000000261
Family Subtilase propeptides/inhibitors 0.0038
Further Details:      
 
Domain Number 3 Region: 407-441
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000103
Family Somatomedin B domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|262194173|ref|YP_003265382.1|
Sequence length 442
Comment peptidase S8/S53 subtilisin kexin sedolisin [Haliangium ochraceum DSM 14365]
Sequence
MQNATTVMIAIVTGLLAGCLESGADHVGTTVAPLHVVPAAKRIPGEYIVVLRDGVTLAAR
DTLRGRVASAGTENQVLGAYSIIPGFAAALDDDMLAELRRSPEVAHIEENAVIQLASIHV
AHADGIDRLDQRVGHDGVYNDYDWAGAGVHVYVVDTGLNRSHDDFAGRVGLSFTTVFDGN
VVNDCHGHGTHVTSTIAGTRYGVAKQAEVHAVRIFDCNAVGTLNNLIQGVEWATDDCLGR
GSPCVLNISHGVPQSAALNQAVATAVAAGITVVTAAGNEGLDACGFSPASEATAITVAAI
DDADTRAAFSNWGSCVDIFAPGVTIQGASIGSRIASAERSGTSMASAHVAGVAAQYLGVH
PEATPAQVALNLGGSASIQCVADAHDSPNVLLFNDLAQGNYDCSVPVGSCANLCGGASDG
CFCDPLCTTYGDCCPDYEQHCE
Download sequence
Identical sequences D0LPC4
502025.Hoch_0875 gi|262194173|ref|YP_003265382.1| WP_012826110.1.83622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]