SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262194512|ref|YP_003265721.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262194512|ref|YP_003265721.1|
Domain Number 1 Region: 105-163
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.0000000222
Family TonB 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|262194512|ref|YP_003265721.1|
Sequence length 166
Comment hypothetical protein [Haliangium ochraceum DSM 14365]
Sequence
MFEDNGKPEHAREHYAAGCRRYLERSTEPYASAVQQRFCQRAREFGVVPSAESIEDGESG
GPSAPQFVVGHVVEARRVHGSPAIAPSLDIRRAMAANSISRIDATLRLCLSPSGLVQEAK
LLESSQFVDYDRVLLETLRGWRYSPFTVDGVPSPVCTLIILVYSQS
Download sequence
Identical sequences D0LTD3
gi|262194512|ref|YP_003265721.1| 502025.Hoch_1268 WP_012826437.1.83622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]