SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262195494|ref|YP_003266703.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262195494|ref|YP_003266703.1|
Domain Number 1 Region: 49-397
Classification Level Classification E-value
Superfamily Subtilisin-like 3.67e-64
Family Subtilases 0.0000119
Further Details:      
 
Domain Number 2 Region: 435-472
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000562
Family Somatomedin B domain 0.0014
Further Details:      
 
Domain Number 3 Region: 478-513
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000837
Family Somatomedin B domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|262195494|ref|YP_003266703.1|
Sequence length 514
Comment peptidase S8/S53 subtilisin kexin sedolisin [Haliangium ochraceum DSM 14365]
Sequence
MQARNVFRFMAAGLISSALATGCATVEEDFIEDVGSTSAPLLGMDSPDIIPGQYIVSFKS
DIGAQNVNAAMNRVSLKSKSSRIQHTYAGAFNGFAAKLSDADLQDILKNDSVAFVEADQM
MYATATKPSSGQLELDRHHACPAVDDGVFDDHGCDGSGVRVYIVDTGIRGSHNEFTGRMA
TGFDAINDGNGTNDCQGHGTHVASTAAGNQFGMANRATLVPVRVLSCSGSGSNSGVIAGV
NFVASDCQGRRCVANMSLGGGASSALDNAVTSAVNAGIAFAVAAGNDNSNASGFSPARAA
AAITVGAASDSGYPASTNSNSVTRASFSNFGSVVDIWASGLSILGANINSNSSTQTISGT
SMASPHVAGAIAQMLGCLGNMTPAQVEAQLNAKSITGAMSNEQGAEDRFLCSDFNSANDA
GDCDCGGGSEPPPADSCEGRCGTFDSGASCQCDDQCADFGDCCPDKAAECDAPQPGPDTC
FQACGVFNSSRQCQCDSACSNFGDCCPDLGQFCN
Download sequence
Identical sequences D0LHY1
502025.Hoch_2267 gi|262195494|ref|YP_003266703.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]