SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262195495|ref|YP_003266704.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262195495|ref|YP_003266704.1|
Domain Number 1 Region: 138-387
Classification Level Classification E-value
Superfamily Subtilisin-like 8.38e-70
Family Subtilases 0.00000475
Further Details:      
 
Domain Number 2 Region: 50-120
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000000000181
Family Subtilase propeptides/inhibitors 0.0028
Further Details:      
 
Domain Number 3 Region: 426-464
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000119
Family Somatomedin B domain 0.0016
Further Details:      
 
Domain Number 4 Region: 471-506
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000034
Family Somatomedin B domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|262195495|ref|YP_003266704.1|
Sequence length 507
Comment peptidase S8/S53 subtilisin kexin sedolisin [Haliangium ochraceum DSM 14365]
Sequence
MQARNLFRLMAVGILGGSFATGCAAVEEDFAESVATTTAPLLGDASTAIEGEYIVKFKDD
VAAKGVGIAMNRVSLASANSRIMREYKTFPGFAAKLDKRDLQNLQKNPDVEYLEFNGRME
ALKIENVQADGIDRIDQRSGRNGQYNDSDLTASGVTAYIVDTGIRSTHNEFTGRVAGTID
FVGDGQTEDCNGHGSHVASTVAGTQFGVADGAQIYGVRVLNCSGSGSFAGVISGIDFVAQ
DCSGDCVANMSLGGGFSQAVNDAVEAAVAAGIPFAVASGNSNADSCGFSPASAPSAITVD
AAADNDSRASFSNFGSCSDLYAPGVSILGADIGSDSDTQSISGTSMASPHVAGVMAQILD
CNPGATPAEVEAILKAAATSGAISNPNGTANLLLYTDSAELCGGAPDPDPDPDPDPEPDP
DPDPDPGSCSGRCGSFDSGAICQCDDACESFGDCCPDFEDECQGGPTPGPDTCFDACGVF
DSSRECQCDSSCVFFGDCCADLGDFCS
Download sequence
Identical sequences D0LHY2
502025.Hoch_2268 gi|262195495|ref|YP_003266704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]